KEGG   Pantoea ananatis LMG 20103: PANA_2089Help
Entry
PANA_2089         CDS       T01195                                 

Gene name
adhE
Definition
hypothetical protein
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PANA_2089 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_2089 (adhE)
   00620 Pyruvate metabolism
    PANA_2089 (adhE)
   00650 Butanoate metabolism
    PANA_2089 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA_2089 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PANA_2089 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA_2089 (adhE)
   00626 Naphthalene degradation
    PANA_2089 (adhE)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PANA_2089 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PANA_2089 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2335387..2338071
Genome map
AA seq 894 aa AA seqDB search
MAVTNVAELNALVERVKKAQQEFANFSQQQVDAIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLDTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDIIGWIDAPSVELSNQ
LHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADVKRAVASILMSKTFD
NGVICASEQSVIVVDAVYDAVRERFASHGGYLLQGQELSAVQNIILKNGGLNAAIVGQPA
VKIAEMAGISVPGETKILIGEVERVDESEPFAHEKLSPTLAMYRAKDYQDAVSKAEKLVA
MGGIGHTSCLYTDQDNQTARVHYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLGC
GSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEIATDGAKR
AFVVTDRFLFNNGYADQVTRVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVII
ALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKARMVAITTTSGT
GSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPRSLCAFGGLDAVTHALEA
YVSVLANEYSDGQALQALKLLKENLPASYAEGAKNPVARERVHNAATIAGIAFANAFLGV
CHSMAHKLGSEFHIPHGLANSLLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIADH
LGLTAPGDRTAQKIEKLLVWLDEIKTELGIPASIREAGVQEADFLAKVDKLADDAFDDQC
TGANPRYPLIAELKQLMLDSYYGRKFVEPFASAAEAAQAQPVSDSKAAKKAKKA
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccgttactaatgtcgctgaactcaatgcactggttgaacgtgtaaaaaaagcccag
caagaattcgccaatttttctcaacaacaggtcgatgccatcttccgcgcagccgcactg
gccgccgcggatgcccgaattccactcgctaaaatggcggtggcagaatcgggcatgggc
attgttgaagacaaagtcattaaaaatcacttcgcttctgaatacatctacaacgcctat
aaggatgagaaaacctgcggcgtactggacaccgatgatacgtttggcaccatcacaatc
gctgaacccatcggcctgatttgcggtatcgtccccaccactaaccctacctccaccgcg
attttcaaggcacttatcagccttaaaacccgcaacgggattatcttctccccccatcct
cgagccaaagatgcgacgaacaaagcggcggatattgtcctgcaggcagcgattgccgct
ggcgcgcccaaagacattataggctggattgatgcaccttctgtggaactgtccaatcag
ttgcaccatcctgatattaacctgattctggcgacgggtggccccggcatggtcaaagcc
gcctacagctcaggtaagccggcgattggcgtgggggccggtaacacgcccgttgtcatc
gatgaaacagctgatgttaaacgcgccgttgcctccatcctgatgtcaaaaacgtttgat
aacggtgtgatctgtgcctctgaacagtcggttatcgtggtggatgccgtctacgacgcc
gtgcgcgagcgcttcgccagccatggtggctatttgcttcagggacaggaactgagtgcg
gtacaaaatatcattctaaaaaacggtgggcttaacgccgccattgtgggccagcctgcg
gtgaagattgcggagatggccggcatcagcgtacctggtgaaaccaaaatcctgattggc
gaagttgaacgggtcgatgaatcagagcctttcgctcatgaaaaactgtcgccgacactg
gcgatgtaccgtgctaaagattatcaggatgccgtcagcaaagcggagaaactggtggcg
atgggtggtattggtcatacgtcatgcctgtataccgaccaggacaatcagacagcgcgc
gtgcactattttggcgacaagatgaaaacagcccgcattctgatcaacacgccagcttct
cagggcggtattggtgatttatataacttcaaactcgccccttctctgacactgggttgt
ggttcctggggcggtaactccatttctgaaaacgtggggcccaaacatctcatcaacaag
aaaaccgtcgctaagcgagctgaaaatatgttgtggcataaacttccgaagtccatttac
ttccgtcgcggctctttacccattgcgcttgaagagatcgccaccgacggtgccaaacgc
gcgtttgtggtgactgaccgcttcctgtttaacaacggttatgccgatcaggtcacccgc
gttttaaaatctcacggcatcgaaaccgaagttttctttgaggttgaagcggatcccacc
ttaagcatcgtgcgtaaaggtgcagaacagatgaacagctttaagccagacgtgatcatc
gccctgggcggcggttcgccgatggatgcagccaaaatcatgtgggtcatgtatgagcat
cctgaaacccattttgaagagctggcactgcggtttatggatattcgcaaacgtatctat
aagttccctaaaatgggcgtgaaagcgcgcatggtggccattacgacaacctcaggcaca
ggttcagaagtgacgccttttgccgtggtaacggatgacgcgaccggacagaaatacccg
ctggccgattatgcgctgacgccggatatggctatcgttgatgccaacctggtcatggat
atgccacgttcactctgtgccttcggcggtctggatgcggtgacgcacgcgctggaagcc
tatgtgtccgtcctggccaatgaatactccgatggtcaggccctgcaggcgcttaagctg
cttaaagagaacttaccggcgagttatgcagaaggtgcaaaaaatccggttgcccgtgaa
cgtgtacataatgccgccaccatcgccggtatcgcctttgcgaacgccttcctcggggtt
tgtcactcaatggcgcataagcttggctctgagttccatattcctcatggactggctaac
tcgctgctgatttccaacgttattcgctataacgccaatgacaaccctactaagcaaacc
gcattcagccagtacgatcgtccccaggcgcgtcgtcgttatgctgaaattgcggatcat
cttggtctcaccgcgccgggcgaccgcactgcccagaaaattgagaagctgctggtatgg
ctggatgaaatcaaaacggaactgggtattccggcctcaattcgtgaagccggtgtgcag
gaggctgacttcctggcgaaagtcgataaactggcggatgatgcctttgatgaccagtgt
actggcgcgaatccacgttatccgctgattgccgaactcaaacagctgatgctggacagc
tactacggacgcaaatttgtcgagccgttcgccagtgccgccgaggctgcccaggctcag
cctgtcagtgacagcaaagcggcgaagaaagctaaaaaagcctaa

DBGET integrated database retrieval system