KEGG   Pantoea ananatis LMG 20103: PANA_2094Help
Entry
PANA_2094         CDS       T01195                                 

Gene name
galU
Definition
GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA_2094 (galU)
   00052 Galactose metabolism
    PANA_2094 (galU)
   00500 Starch and sucrose metabolism
    PANA_2094 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_2094 (galU)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PANA_2094 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342230..2343141)
Genome map
AA seq 303 aa AA seqDB search
MMSAYKTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVL
VTHSSKNAIENHFDTSFELESMLEKRVKRQLLDEIQSICPPHVTIMQVRQGIAKGLGHAV
MCAHPLVGDEPVAVILPDVIIDEYESNPTKDNLAEMLSRYEESGRSQIMVEPVSDVTAYG
VVDCQGAELNPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLAKTPPGAGGEV
QLTDSIAMLMDKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHPVLGKEFTEWLNNTVS
DKK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtctgcctataagaccaaagtaaaaaaagcggtaattccagtagcgggtttgggt
acacgtatgttgcctgctaccaaagcgattccaaaagaaatgttgccgctggttgataag
ccgttaattcagtatgtcgttaacgagtgtattgctgcgggtattaatgagattgtgctg
gttactcactcctctaaaaacgccattgagaaccattttgataccagttttgaactggag
tctatgctggaaaaacgcgtcaagcgccagctgctggacgaaattcagtccatctgtcct
cctcacgtgaccatcatgcaggtccgtcagggcatcgcgaaaggtctgggccatgcggtc
atgtgtgcacatcctctggtcggcgatgaacctgttgcggtcatcctgcctgacgtgatc
atcgacgaatacgaatctaacccaaccaaagataacctggcagaaatgctgagccgttac
gaagagtctggccgtagtcagatcatggttgagcccgtcagcgatgtgacggcatacggt
gttgtggattgtcagggtgcagaactgaatcctggtgacagcgcgccgatggtcggggtt
gttgagaaacctaaagcgtctgaagcgccatccaaccttgcggttgtcggtcgttacgtt
ctgtctgcggatatctggccactgctggcgaaaacgcctccaggtgccggtggcgaagtt
cagctcaccgactccatcgccatgctgatggataaagaaaccgtcgaagcctatcacctg
aaaggggtaagccacgactgtggtaataaactgggttatatgcaggctttcgttgaatat
ggtgtccgccatccggtattgggtaaagagttcactgaatggctcaacaatactgttagc
gataaaaagtaa

DBGET integrated database retrieval system