KEGG   Pantoea ananatis LMG 20103: PANA_2225Help
Entry
PANA_2225         CDS       T01195                                 

Gene name
cheB
Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pam02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pam02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2476413..2477507)
Genome map
AA seq 364 aa AA seqDB search
MAAWANRVWTDEGKMMSKITVMCVDDSALMRQLMTEIINSHPDMEMVATAPDPLVARDLI
KQFNPQVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTGQGSEITLRALELGAIDFV
TKPQLGIREGMLAYSQMIGDKIRAAARARLHVRNVMPAPVTLKAGPLLSSEKLIAIGSST
GGTEAIRHVLQPLPATSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERILPGHA
YIAPGAMHMELGRSGANYVVKLNEGPPVNRHKPSVDVLFKSVAINAGRNAVGVILTGMGN
DGAAGMLEMHRAGAWTIAQNEASCVVFGMPREAIASGGVSEVVDLSNISQHMLAKISAGQ
ALRI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttggctgcgtgggcaaaccgtgtatggactgacgaaggaaagatgatgagcaaaattacc
gtgatgtgcgtagatgactctgcgctgatgcggcaactgatgaccgaaatcatcaacagt
catcctgatatggaaatggtggctacggccccggatccgttagtggcacgcgatctgatt
aaacagtttaatccgcaggtgttaacgctggatgttgaaatgccgcgcatggacggcctg
gactttcttgaaaaactgatgcgtttacggcccatgcccgtggtcatggtgtcatccctg
acgggacagggctcagaaatcacgctgcgcgcgctggagttaggtgcgatcgatttcgtg
acgaagccgcagttaggcattcgtgaaggcatgctggcctacagccagatgattggcgac
aaaattcgcgcggcggcccgggcgcgcctgcatgttcgtaacgttatgcccgcgccggtc
acgctgaaagccggcccgttgctgagtagtgaaaagttgattgccattggttcatcaacc
ggcggcacagaggcgattcgccacgttttacagccgttaccggccaccagtccggcactg
ctgattacgcaacatatgccaccgggctttacccgatcttttgccgagcggctgaacaag
ctgtgccagatcacggtgaaagaagcggaagatggcgagcgtattcttcccggccatgcc
tacatcgcgcctggcgcaatgcacatggaactggggcgcagcggggcgaactacgtggtg
aagctgaatgaaggccccccggttaaccggcataaaccttcagtggatgtcttgtttaaa
tcggttgcgattaacgccgggcgtaatgccgtcggcgtcatcctgaccggtatgggtaac
gatggggcagcaggcatgctggaaatgcatcgtgccggcgcctggaccatcgcgcaaaat
gaagcaagttgtgtcgtttttggcatgccacgcgaggcgatagccagcggtggcgtgagc
gaagtagtagatttaagcaacatcagccagcacatgctggcgaaaattagcgccggacag
gcattgcgtatataa

DBGET integrated database retrieval system