KEGG   Pantoea ananatis LMG 20103: PANA_2267Help
Entry
PANA_2267         CDS       T01195                                 

Gene name
rfbC
Definition
RfbC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PANA_2267 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PANA_2267 (rfbC)
Enzymes [BR:pam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PANA_2267 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2528912..2529295
Genome map
AA seq 127 aa AA seqDB search
MKVKATKIADVKIIQPAVYGDDRGFFLETFEKRRYQELLETHLEFVQDNYSRSGRHVLRG
LHFQKTEPQGKLVRVVRGEVFDVAVDIRPGSPTFGQWESILLSEENKNAAVDSPRTRARF
CRPFGRR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcaaagccactaaaattgccgatgttaaaatcatccagccagcggtttatggt
gacgatcgtggttttttcctggaaacgtttgaaaaacgtcgctatcaggagttacttgaa
acccacctcgaatttgtgcaagacaactattcgcgctcaggccgacatgtattacgcggc
ttacattttcagaaaacagagccccagggcaagctggtgcgcgtcgtgcggggcgaagta
ttcgatgttgcagtcgacatccgtcccggttctccgacctttggtcagtgggagagtatt
ctgctttctgaagaaaataaaaacgcagctgtggattccccccggactcgcgcacggttt
tgtcgtcctttcggacgtcgctga

DBGET integrated database retrieval system