KEGG   Pantoea ananatis LMG 20103: PANA_2492Help
Entry
PANA_2492         CDS       T01195                                 

Gene name
manC
Definition
ManC
Orthology
K00971  
mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pam00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pam00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2776017..2777432)
Genome map
AA seq 471 aa AA seqDB search
MLLPVIMAGGTGSRLWPLSRELYPKQFICLHGEHSMLQETVTRLTGIEARAPMVICNEEH
RFLVAEQLRQINKLSHNIILEPVGRNTAPAIALAALNAVEQGDDPVLLVLAADHVIEDRV
AFHEAIEVATAYAKQGKLVTFGIVPSGPETGYGYIQRGEILPGAENGPWKVQRFVEKPNK
NTAEQYLESGEYYWNSGMFMFRAKRYLQELEKFRPDILEACRNAMANVKEGKDFISINKD
DFIACPDESVDYAVMEQTDAAVVVPLAAGWSDVGSWSALWEVNEKDVHGNSLKGDTFLHN
TKNCYINSEDQLVAAIGVENLVIVNTKDAVLVARKDQVQDVKRVVEFLKGECRSEYRRHR
ETYWPWGRCDLVVNTGRFNVNRITVKPGESFELQMHYHRTEHWVILSGTAKVTIQDKTLL
LTENQSTFIPIGHPHTLENPGKIPLELLEIQSGSYLGDDDLILIKQQFASK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttcccgtaatcatggccggaggaaccggcagccgcttatggcccctttcgcgt
gagctttatcctaaacagttcatctgcctgcatggtgaacactccatgctacaagaaacc
gttacccgactaacgggcattgaagctcgggcacctatggttatctgcaacgaagagcat
cgctttttagtggcagagcagctgcgacagatcaacaagttgtcgcataacatcatttta
gagccagtgggcagaaatactgcacctgcaatcgccttagctgcactgaatgctgtggag
cagggagatgatcctgtcctactggtacttgctgcggaccacgttattgaagatcgtgtt
gccttccatgaggccatagaggtcgctaccgcctatgctaaacagggcaaactagtgact
ttcggtatcgtaccttcaggaccggaaacgggatatggctacattcagcgtggtgaaatt
ctgccgggcgcagaaaacggcccctggaaagttcagcgttttgtcgaaaaacctaataag
aatacagctgagcaatatctggagtcgggcgaatactactggaatagcggaatgttcatg
tttagagcaaaacgctatctccaggaacttgaaaaattccgcccggatatactggaagcc
tgtcgtaacgcaatggctaatgtgaaagaaggtaaagatttcatcagcatcaacaaagat
gattttatcgcctgccccgatgagtcggttgattatgcagtaatggaacaaactgatgct
gcagtggtagtaccattagctgcgggatggagcgatgtcggttcctggtcagcgctatgg
gaagtgaacgaaaaagatgttcatggtaactcccttaaaggtgacaccttccttcacaac
actaaaaactgttatatcaatagtgaagaccaactagtggcagctataggtgtggaaaac
ctggtaatcgtaaacaccaaagacgccgtattggttgcacgcaaagatcaggtccaggat
gttaagcgcgtggttgagtttctgaaaggcgaatgtagaagcgagtaccgtcgtcaccgc
gaaacttactggccgtggggccgctgtgatttggtagtaaatactggtcgtttcaacgta
aaccggatcacagtaaaacccggggagtcatttgagttacagatgcattatcaccgtaca
gagcactgggtgattctttcgggaacagcgaaagtcacaattcaggacaaaacactgtta
ttaactgaaaatcagtcaacgtttattcctattggtcatccccataccttagaaaaccca
ggtaagattccattagaacttctggaaattcagtcaggatcatacctaggtgatgatgac
ctgattttgattaaacaacagtttgctagtaagtaa

DBGET integrated database retrieval system