KEGG   Pantoea ananatis LMG 20103: PANA_2494Help
Entry
PANA_2494         CDS       T01195                                 

Gene name
galF
Definition
(GenBank) GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00040  Pentose and glucuronate interconversions
pam00052  Galactose metabolism
pam00500  Starch and sucrose metabolism
pam00520  Amino sugar and nucleotide sugar metabolism
pam01100  Metabolic pathways
pam01130  Biosynthesis of antibiotics
Module
pam_M00362  Nucleotide sugar biosynthesis, prokaryotes
pam_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA_2494 (galF)
   00052 Galactose metabolism
    PANA_2494 (galF)
   00500 Starch and sucrose metabolism
    PANA_2494 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_2494 (galF)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PANA_2494 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 PvlArgDC
Motif
Other DBs
NCBI-ProteinID: ADD77661
UniProt: D4GIC7
Position
complement(2779351..2780283)
Genome map
AA seq 310 aa AA seqDB search
MTHVFTSLDGITMTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAG
IKEIVLVTHASKNAVENHFDTTYELEALLEARVKRQLLSEVQSICPPGVTIMNVRQAQPL
GLGHSILCARPMIGDNPFVVVLPDVLLDDSTADHLRYNLAAMVARFEETGHSQVLAKHLT
DYDLSEYSVITTEQPLENPGDVSTITDFVEKPEHPAELNSDLAAVGRYVLSADIWAELER
TEPGAWGRIQLTDAIASLSKKKTVDVSLMTGHSFDCGRKMGYMQAFVSYGLRNNAQGRDF
REAIEKILAK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcatgtcttcacttcattagatggaataactatgaccaagcttaaagcagtaatc
ccggttgcgggtctcggtatgcatatgcttccggcgactaaagccattccgaaagagatg
ctgcctgtcgtggacaagccaatgattcaatacatcattgatgagtgtgttgcagcaggg
atcaaagagattgtgctggtcacccatgcgtccaagaatgcggtagaaaaccacttcgat
accacctatgaactcgaagccctgctggaagcacgcgttaaacgccagctgctgagtgaa
gtccagtcaatctgcccgccgggcgtgaccatcatgaacgtacgtcaggcgcagccactg
ggcctggggcattctattctctgcgcgcgtcctatgatcggcgataatccttttgtggtt
gtcctgcctgacgtgctgttggacgattccaccgctgaccatttacgatataatctggcg
gcaatggttgcgcgttttgaagagaccggtcacagccaggtgctggcaaaacacctcacc
gactacgatctgtctgaatactcagtgatcacgactgagcagccgctggaaaacccaggt
gatgtcagcacgattactgacttcgttgagaaacctgagcacccggccgagttaaactca
gacctggcagcggtgggacgctacgtgctttcagccgatatctgggctgagctggagcgt
accgaaccgggggcatggggccgtattcagttaacggacgctatcgccagcctgagtaag
aagaaaacggtcgatgtctcactcatgacgggtcacagtttcgactgcggacgtaaaatg
ggttacatgcaggcatttgtctcctacggtctgcgcaataacgctcagggccgcgacttc
cgcgaagcgatcgagaaaattctggcgaagtaa

DBGET integrated database retrieval system