KEGG   Pantoea ananatis LMG 20103: PANA_2544Help
Entry
PANA_2544         CDS       T01195                                 

Gene name
folE
Definition
FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PANA_2544 (folE)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PANA_2544 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2845452..2846117)
Genome map
AA seq 221 aa AA seqDB search
MSTLSQEAAQVHEALLARGLETPLRAPTREIDDETRKSLIAGHMTEIMQLLNLDLEDDSL
METPHRIAKMYVDEVFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKDKVIGLSKINRIVQFFAQRPQVQERLTQQVLLALQTLLGTNNVAVSIDAVH
YCVKARGVKDATSATTTTSLGGLFKSSQNTRQEFLRAVRHN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgagtcaggaagctgcacaggtccacgaagcgctgctggcgcgtgggctg
gaaacgccgctgcgcgcacccacgcgtgaaatagacgatgaaacgcgtaagagcctgatt
gcaggccatatgacggaaatcatgcagctgctgaatctggatcttgaagatgacagcctg
atggaaaccccgcatcgcatcgccaaaatgtatgtcgatgaggtcttttccggtctcgat
tatgccaacttccccaaaatcacgctcatcgaaaacaagatgaaagtggatgagatggtg
acggttcgcgacattacgctgaccagtacctgcgaacatcattttgtgattatcgacggg
aaagccaccgtcgcgtatatccctaaagataaggtgatcggcttatccaagatcaaccgc
atcgtgcagttcttcgcgcagcggcctcaggtgcaggagcgtttaacacagcaggtcctg
ctggcgctgcaaacgctgttgggaacgaataacgttgccgtttcgatcgatgccgttcac
tactgtgtgaaagcgcgcggcgtgaaggatgccaccagcgccacgaccacgacctcgctg
ggtgggctgtttaaatccagtcaaaatacccgtcaggaattcctgcgcgcggtgcgtcat
aactaa

DBGET integrated database retrieval system