KEGG   Pantoea ananatis LMG 20103: PANA_2744Help
Entry
PANA_2744         CDS       T01195                                 

Gene name
glk
Definition
Glk
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA_2744 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_2744 (glk)
   00052 Galactose metabolism
    PANA_2744 (glk)
   00500 Starch and sucrose metabolism
    PANA_2744 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_2744 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PANA_2744 (glk)
   00524 Butirosin and neomycin biosynthesis
    PANA_2744 (glk)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PANA_2744 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3081358..3082437)
Genome map
AA seq 359 aa AA seqDB search
MHTRVRRSPITSVSVVVLSAGFYSVLQLFKTPKRSTRRMTTYALVGDVGGTNARLALCEV
ENGSISQAKTFATSDYDSLEAVIRHYLDEQKQDIKDGCIAIACPITDDWVEMTNHDWAFS
TKKLKENIGFEHLEIINDFTAVSMAIPMLGAEHVIQFGGKEPIKDKPVAIYGAGTGLGVS
HLVHVDKRWVSLPGEGGHVDFAANSEEEDQILEVLREELGHVSAERVLSGAGLVNLYRAI
VKVDHRVPENLKPKEVSERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVYIAG
GIVPRFLEFFKSSGFRAAFEDKGRFRDYVATIPVYMITHDQPGLLGAGAHLRQTLGRII
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgcacacacgagtcagacgctcaccaataacttcggtgagcgttgttgttttatcggca
ggattttatagtgtcctccaactctttaagacccccaagcggagcaccagaagaatgaca
acttatgccttggtcggcgatgtcggcggcaccaatgcccgtctcgctttgtgtgaggtg
gaaaacggcagcatctcccaggccaaaacattcgcaacatcagactacgacagcctcgaa
gccgtcatccgccactatcttgatgaacaaaagcaggatatcaaagacggttgtatcgcc
attgcctgcccgattaccgatgactgggttgagatgaccaaccacgactgggcattttcg
accaaaaagctgaaagaaaacatcggttttgaacacctggagattattaacgacttcaca
gcggtttccatggccatccctatgctgggtgcggaacatgtcattcagtttggtggcaaa
gagccgatcaaggataagcctgtggccatttacggcgcgggtaccgggctgggcgtgagt
catctggtccatgttgataagcgttgggtcagtctgcccggcgaaggcggccacgttgac
tttgcggccaacagcgaagaagaagatcaaatcctcgaagtgttgcgggaagagctaggc
catgtgtcggccgagcgcgttctgtccggcgcggggctggtcaatctctatcgggcgatt
gtgaaagtcgatcatcgtgtccccgaaaatctcaagcccaaagaagtgagtgagcgtgcg
cttgctgacagctgcaccgactgccgtcgtgcactgtcgctgttctgcgtgattatggga
cgtttcggcggtaacctggccctgaaccttggcaccttcggtggagtgtacatcgcgggc
ggtatcgtgccgcgcttcctggagttcttcaaatcgtcgggcttccgggcggccttcgaa
gacaaagggcgctttcgcgattatgtcgccacgattccggtctatatgatcacccacgat
caacccggattattaggcgctggcgcgcacctgcgccaaacgctgggccgcattatctaa

DBGET integrated database retrieval system