KEGG   Pantoea ananatis LMG 20103: PANA_2800Help
Entry
PANA_2800         CDS       T01195                                 

Gene name
dapE
Definition
DapE
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pam01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pam00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3147619..3148746
Genome map
AA seq 375 aa AA seqDB search
MFCPVIELTQQLIRRPSLSPDDAGCQALLIARLEAIGFHIETMNINDTLNFWATRGEGET
LAFAGHTDIVPPGDASRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAVHPH
HKGRLAFLITSDEEASGANGTVKVVERLMARNERLDYCLVGEPSSNEVVGDVVKNGRRGS
ITANLTVHGVQGHVAYPQLADNPVHRALPALNELVATEWDQGNAFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDTLIQQRVAELLDRHQLRYTIEWKLSGQPFLTSRGKL
VDAVVNAVTHYNEIKPQLQTSGGTSDGRFIARMGSQVVELGPVNATIHKINECVKASDLQ
MLSRMYQRIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtccggtcattgagctgacgcagcagcttattcgtcgcccttctctcagcccc
gatgacgccggatgtcaggcgctgctgattgcacgcctggaagcgataggtttccacatc
gaaaccatgaacatcaacgacacgctgaatttctgggccacgcgcggcgaaggcgaaacc
ctggcgtttgccggccacaccgatattgttcccccgggcgatgccagccgctggattaat
cccccgtttgaacccaccatccgcgacggcatgctgtttgggcgcggtgcagcggatatg
aaaggatcgctggccgccatggttgttgccgccgagcggtttgtcgccgttcatcctcat
cacaaggggcgtctggcctttttaattacgtctgacgaagaagccagcggcgcgaacgga
acggtaaaagtggttgagcgcctcatggcgcgtaacgagcgtctggattattgcctggtc
ggagaaccttccagcaacgaagtcgtgggtgacgtcgtgaaaaatggtcgtcgtggctcc
atcaccgcgaacctgaccgtgcatggcgtacagggccatgtagcctatccccaactggcg
gataatcccgtgcaccgtgctctgccggcgcttaacgagctggtcgccacggaatgggat
cagggtaacgcctttttcccggccaccagcatgcagatcgccaacattcaggcgggaacc
ggcagtaacaacgtcatccccggcgagctgtttgtgcagttcaacttccgtttcagtacg
gaactcaccgataccctgattcagcagcgtgtcgcagaactgctggaccgccatcagttg
cgttacaccattgagtggaagctttccggccagccattcctgacctcacgcggcaagctg
gttgatgccgtggtcaacgccgttacgcactataatgaaattaagccgcagttgcagact
tctggtggaacctctgacggacgttttatcgctcgtatgggctcgcaggtggtggaactg
ggtccggtgaatgccacgattcacaaaattaacgaatgcgtgaaagcatcagacttacaa
atgctgagtcggatgtatcaacgcatcatggaacaattgatcgcctga

DBGET integrated database retrieval system