KEGG   Pantoea ananatis LMG 20103: PANA_3008Help
Entry
PANA_3008         CDS       T01195                                 

Gene name
yphC
Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PANA_3008 (yphC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_3008 (yphC)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA_3008 (yphC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PANA_3008 (yphC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PANA_3008 (yphC)
   00626 Naphthalene degradation
    PANA_3008 (yphC)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PANA_3008 (yphC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3373685..3374788)
Genome map
AA seq 367 aa AA seqDB search
MKSNFRIERYNFMNAYDEGLLMKAVIYESFLSPPMLQTVPDPTPEPHGVVIRVKATGVCR
SDWHGWVGHDPDIPLPHVPGHEFAGTIEAVGNAVTKWRPGDNVTVPFVSGCGFCHECHTG
NQQVCDHQFQPGFTHWGSFAEYVAIQQADLNLIALPDTLNFTTAASLGCRFITSFRAVVD
QGRTSAGQWLAVHGCGGVGLSAIMIANALGANVVAVDISDEKLQLARDLGAVAVVNGARV
HNVAEAIREITQGGAHVSLDALGHTVTCVNSIHSLRKRGRHIQIGLMAGEHSAPPIPMAS
VIANELEIIGSHGMQAHRYGDMMNMIATGKLCPQKLIGRTISLEQSIEALINMDKFESPG
VTVVTTF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaatttccggatcgaaaggtataattttatgaacgcctacgatgagggttta
ctgatgaaagcagtgatatacgagtcatttctgtcgccgccgatgctgcaaacggtcccg
gaccctactcccgagccgcacggcgtggtgattcgggtcaaagccaccggtgtttgccga
agtgactggcacggctgggtcgggcacgatcccgatattcctctgcctcatgtgccggga
cacgaattcgcaggcacaattgaagccgttggcaacgcggtgactaaatggcggccgggc
gataatgtcacggtaccttttgtatcggggtgcggcttttgtcacgaatgtcataccggt
aatcagcaggtctgtgaccatcagttccagcctggcttcacgcactggggatcgttcgcc
gaatacgtagcgatacagcaggccgacttaaatcttatcgcactgccggacacgctgaac
ttcactaccgcagccagtctcgggtgccgttttattacctcgttcagggcagtggtcgat
cagggaagaacgtcggcaggtcagtggcttgccgtgcacggctgtggcggtgtgggactt
tccgccatcatgatcgcgaatgcgctcggagcaaacgtggtggcggtggatatttcggat
gaaaagctgcagctggcccgtgatttgggtgcagttgccgtagtaaatggcgctcgcgtg
cacaatgtggcggaagccatcagagaaatcacccaaggcggagcacatgtgtcactggat
gcgctgggtcatactgtgacctgcgtgaactccattcattccctaagaaaaagaggcagg
cacatccagataggcctgatggcgggcgaacacagtgcaccgcccattccaatggccagc
gttattgctaacgaactggagattattggcagtcacggcatgcaggctcatcgttacggc
gacatgatgaacatgatcgccaccggtaaactctgtcctcaaaagctcattggccgtacc
atcagcctcgagcaatccatagaagcgttaatcaatatggataagtttgaatcaccaggc
gtcacggtagtcacgacgttctga

DBGET integrated database retrieval system