KEGG   Pantoea ananatis LMG 20103: PANA_3106Help
Entry
PANA_3106         CDS       T01195                                 

Gene name
recD
Definition
(GenBank) RecD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PANA_3106 (recD)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PANA_3106 (recD)
DNA repair and recombination proteins [BR:pam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     PANA_3106 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_22 DUF2075 AAA_28 AAA_16 UvrD_C PhoH CbiA T2SSE IstB_IS21 AAA_5 PIF1 FtsK_SpoIIIE MukB SRP54 TrwB_AAD_bind NTPase_1 AAA DEAD DUF87 AAA_24
Motif
Other DBs
NCBI-ProteinID: ADD78273
UniProt: D4GLM0
Position
complement(3484244..3486091)
Genome map
AA seq 615 aa AA seqDB search
MSDINALLLQAVEKRLLRPLDIQFARLIADDAQPFLLLAAACVSADAGEGHVCLPLANLS
EAGLFAGRQPALAQALWQAAGAPDDVHAALAGWSAISDGSAVTPLVLSHERLYLHRLWQS
EGQVARFFSLQPDEGTFDAHRASEVLTSLFGSRPDDWQKIAAAVALTRKTAVISGGPGTG
KTTTVAKLLAALIRLNTVPLRIQLAAPTGKAAARLTESLGKALQGLAVSEEERARFPAEA
TTLHRLLGAQPDTQRLRYHAGNLLHLDVLVVDEASMVDLSMMAKLISALPQHARVVFLGD
RDQLASVEAGAVLGDICRCSETGFSPSRAAQLTALTGCTLTGDDVEAAPAVRDSICLLRQ
SYRFDEKSGIGQLARAVNQGDARQMSAIFAAGHQDVSFQPLNDGDAYQAMLDEVARGYSD
YLHAVQHQATPEQVIDAFSRYQLLCALREGPFGVHGLNQRIEQRLMQLQRIRRPALGSRW
YAGRPVMITRNDSALGLFNGDIGITLRDEEGQLRVFFPLPDGSVKAIQPSRLPSHETAWV
MTVHKSQGSEFDHTALVMPTQFLPVLTRELVYTAITRARSQLTLYSDRAIFDRAVQLQTQ
RRSGLVERLGAAGQA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatataaacgccttactgctccaggcagtcgaaaagcgtttactgcgtcctctg
gatatacagtttgcccgcttgattgcggatgacgcccagccttttctgctgctggcagcg
gcctgcgtcagtgccgatgccggagaaggtcacgtctgtctgccgctggctaatctgagc
gaggccggactctttgcggggcgtcagccggccctggcccaggcactgtggcaggccgca
ggcgcgccggacgatgtgcatgctgcactggcgggctggtcagcaatcagtgatggcagt
gccgtcaccccgctggtgctgagccatgagcgtttgtatctgcatcgcttgtggcagagc
gaagggcaggttgcgcgctttttttcgttgcagcccgacgaaggaacatttgatgcgcac
cgggccagcgaggtactgaccagcctgtttggcagccgtccagacgactggcaaaagatt
gccgcagccgtggcgctgacgcgaaaaaccgccgtgatttcaggtgggccgggaaccggt
aaaaccaccacggtggcaaagctgctggctgcgctaatccgattgaatacggtgccgctg
cgcatacagctggcggcgcccacgggcaaagccgcggcccgtttaacggagtcgctgggt
aaagctctgcagggactggccgtgagcgaggaagagcgcgcccggttccctgcggaagcg
acgacgctgcaccgcctgctgggtgcacaaccggacacgcagcgtctgcgctatcacgcg
ggcaatctgttgcatctggatgtgctggtggtcgatgaggcctcaatggtcgacctgagc
atgatggcaaaactgatctctgccttgccacagcatgcgcgcgtggtctttctgggcgat
cgcgatcagctggcttcggtggaggcgggcgccgtgctgggggatatttgccgctgcagc
gaaacaggatttagcccgtcacgggctgcacagctgacggccctgaccggctgcacgctc
acaggcgacgatgttgaggccgcgccagccgttcgcgacagcatttgcctgctgcgacag
agctatcgttttgatgaaaagtccggaataggtcagctggcacgggcggtgaaccagggc
gatgcgcgccagatgagcgcgatttttgccgccggacaccaggatgtttcttttcagccg
ctgaacgacggcgacgcttatcaggctatgctggacgaggtagcgcggggttatagcgac
tatctgcatgccgttcagcatcaggctacgccagagcaggtcattgacgcattcagccgt
tatcagctgttgtgtgccctgcgtgaagggccctttggcgtgcacgggctgaatcagcgc
attgagcaacgcctgatgcagctgcagcgcatcagacgtcctgcgttgggcagccgctgg
tatgcgggaaggccggtaatgatcacccgtaatgacagcgcactggggctgtttaacggc
gatatcggtattactctgcgcgatgaggaaggccagctcagagtcttttttccgttgcca
gacggcagcgtgaaagcgattcagcccagccgtttgccgtctcatgaaaccgcctgggtt
atgacggtacacaagtcgcagggatcggagtttgaccataccgcgctggtcatgccgacc
cagtttctgccggtgctgacccgcgagctggtttataccgcaattacgcgtgcgcgcagt
caactgacgctttacagcgatcgtgcaatatttgaccgcgccgtacagctgcaaacgcag
cggcgaagcgggctggtggaaaggttaggggcggccgggcaggcgtaa

DBGET integrated database retrieval system