KEGG   Pantoea ananatis LMG 20103: PANA_3106Help
Entry
PANA_3106         CDS       T01195                                 

Gene name
recD
Definition
RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PANA_3106 (recD)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PANA_3106 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3484244..3486091)
Genome map
AA seq 615 aa AA seqDB search
MSDINALLLQAVEKRLLRPLDIQFARLIADDAQPFLLLAAACVSADAGEGHVCLPLANLS
EAGLFAGRQPALAQALWQAAGAPDDVHAALAGWSAISDGSAVTPLVLSHERLYLHRLWQS
EGQVARFFSLQPDEGTFDAHRASEVLTSLFGSRPDDWQKIAAAVALTRKTAVISGGPGTG
KTTTVAKLLAALIRLNTVPLRIQLAAPTGKAAARLTESLGKALQGLAVSEEERARFPAEA
TTLHRLLGAQPDTQRLRYHAGNLLHLDVLVVDEASMVDLSMMAKLISALPQHARVVFLGD
RDQLASVEAGAVLGDICRCSETGFSPSRAAQLTALTGCTLTGDDVEAAPAVRDSICLLRQ
SYRFDEKSGIGQLARAVNQGDARQMSAIFAAGHQDVSFQPLNDGDAYQAMLDEVARGYSD
YLHAVQHQATPEQVIDAFSRYQLLCALREGPFGVHGLNQRIEQRLMQLQRIRRPALGSRW
YAGRPVMITRNDSALGLFNGDIGITLRDEEGQLRVFFPLPDGSVKAIQPSRLPSHETAWV
MTVHKSQGSEFDHTALVMPTQFLPVLTRELVYTAITRARSQLTLYSDRAIFDRAVQLQTQ
RRSGLVERLGAAGQA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatataaacgccttactgctccaggcagtcgaaaagcgtttactgcgtcctctg
gatatacagtttgcccgcttgattgcggatgacgcccagccttttctgctgctggcagcg
gcctgcgtcagtgccgatgccggagaaggtcacgtctgtctgccgctggctaatctgagc
gaggccggactctttgcggggcgtcagccggccctggcccaggcactgtggcaggccgca
ggcgcgccggacgatgtgcatgctgcactggcgggctggtcagcaatcagtgatggcagt
gccgtcaccccgctggtgctgagccatgagcgtttgtatctgcatcgcttgtggcagagc
gaagggcaggttgcgcgctttttttcgttgcagcccgacgaaggaacatttgatgcgcac
cgggccagcgaggtactgaccagcctgtttggcagccgtccagacgactggcaaaagatt
gccgcagccgtggcgctgacgcgaaaaaccgccgtgatttcaggtgggccgggaaccggt
aaaaccaccacggtggcaaagctgctggctgcgctaatccgattgaatacggtgccgctg
cgcatacagctggcggcgcccacgggcaaagccgcggcccgtttaacggagtcgctgggt
aaagctctgcagggactggccgtgagcgaggaagagcgcgcccggttccctgcggaagcg
acgacgctgcaccgcctgctgggtgcacaaccggacacgcagcgtctgcgctatcacgcg
ggcaatctgttgcatctggatgtgctggtggtcgatgaggcctcaatggtcgacctgagc
atgatggcaaaactgatctctgccttgccacagcatgcgcgcgtggtctttctgggcgat
cgcgatcagctggcttcggtggaggcgggcgccgtgctgggggatatttgccgctgcagc
gaaacaggatttagcccgtcacgggctgcacagctgacggccctgaccggctgcacgctc
acaggcgacgatgttgaggccgcgccagccgttcgcgacagcatttgcctgctgcgacag
agctatcgttttgatgaaaagtccggaataggtcagctggcacgggcggtgaaccagggc
gatgcgcgccagatgagcgcgatttttgccgccggacaccaggatgtttcttttcagccg
ctgaacgacggcgacgcttatcaggctatgctggacgaggtagcgcggggttatagcgac
tatctgcatgccgttcagcatcaggctacgccagagcaggtcattgacgcattcagccgt
tatcagctgttgtgtgccctgcgtgaagggccctttggcgtgcacgggctgaatcagcgc
attgagcaacgcctgatgcagctgcagcgcatcagacgtcctgcgttgggcagccgctgg
tatgcgggaaggccggtaatgatcacccgtaatgacagcgcactggggctgtttaacggc
gatatcggtattactctgcgcgatgaggaaggccagctcagagtcttttttccgttgcca
gacggcagcgtgaaagcgattcagcccagccgtttgccgtctcatgaaaccgcctgggtt
atgacggtacacaagtcgcagggatcggagtttgaccataccgcgctggtcatgccgacc
cagtttctgccggtgctgacccgcgagctggtttataccgcaattacgcgtgcgcgcagt
caactgacgctttacagcgatcgtgcaatatttgaccgcgccgtacagctgcaaacgcag
cggcgaagcgggctggtggaaaggttaggggcggccgggcaggcgtaa

DBGET integrated database retrieval system