KEGG   Pantoea ananatis LMG 20103: PANA_3130Help
Entry
PANA_3130         CDS       T01195                                 

Gene name
dsbC
Definition
DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pam  Pantoea ananatis LMG 20103
Brite
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PANA_3130 (dsbC)
Secretion system [BR:pam02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PANA_3130 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3515933..3516724)
Genome map
AA seq 263 aa AA seqDB search
MSPRNVCDCYINSIIRAHSWRRVRKTMNKHVAMLALLASAFSGLTHADDSAIQLSLKKLG
LHQAEIQPAPLPGFKTVLTESGVLYVTDDGKHMIQGPLYDVSGAQPVNVTNALLDKKVEA
LVPEMIVYKAPKEQHVVTVFTDITCGYCHKLHEQMADYNALGITVRYLAFPREGMNGKVA
SAMKAVWCSADRNKAFDEAMKGDVPKMDAPASCTIDIGKQYQLGVLFGIQGTPAILTDSG
MMIPGYQSPQELKQVLDNQKRGG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccacggaacgtctgcgactgttacatcaacagcatcatccgcgcgcatagctgg
cggagagtaaggaaaacaatgaacaaacatgttgccatgctggcgctgctggccagcgct
ttttccggtttgacccacgctgatgacagcgccattcagctttccctgaagaaactgggt
ttgcaccaggctgagatccaacctgcaccgctgccgggttttaaaaccgtgctcaccgaa
agcggcgtgctgtacgttaccgatgatggtaaacacatgatccagggaccgctttacgat
gtcagcggtgctcagccggtcaacgtgacgaacgcgctactggataaaaaagttgaggcg
ctggttccggaaatgatcgtgtataaagcgcccaaagagcagcatgtggtgacagtgttt
acggatatcacctgtggctactgccacaaactgcacgaacaaatggctgactacaacgcg
ctgggcatcaccgttcgctatctggctttcccacgtgaaggcatgaacggcaaagttgcc
agcgccatgaaggccgtgtggtgcagcgccgatcgcaataaagcctttgatgaggcgatg
aaaggcgatgtgccgaagatggatgcgccagcctcctgcacgattgatatcggcaagcag
taccagcttggcgtactgtttggtatccagggcacgccggcgattctgactgatagtggc
atgatgatccccggctatcaaagtccacaggagctcaagcaggtactggataatcaaaag
cgtggtggttaa

DBGET integrated database retrieval system