KEGG   Pantoea ananatis LMG 20103: PANA_3151Help
Entry
PANA_3151         CDS       T01195                                 

Gene name
nucD2
Definition
NucD2
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pam  Pantoea ananatis LMG 20103
Brite
Enzymes [BR:pam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PANA_3151 (nucD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3531587..3532102)
Genome map
AA seq 171 aa AA seqDB search
MNLQTVKRCAVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLKPYLCNAGVWTDGIG
NTRGVVPGKSITERQAAGTFITNVLRVEAALARCVAVTMPQQVYDALVSLAFNVGTGNVC
ASTMVKLIRASRWRDACYQLPRWVYVKGVFNQGLDNRRGRELGWCLKGAAA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcaaaccgttaaacgctgcgccgtgggcgcggtactggccatcgccgccacg
ctgccgggctttcagcagctgcacacctctgttgaggggctgaaactgattgctgattac
gagggctgccgcctgaaaccttacctgtgcaatgcgggcgtgtggactgacgggatcggc
aacacgcggggcgttgtgccgggcaaaagcattaccgagcggcaggccgccgggacgttc
atcaccaacgtgttacgcgttgaggcggcactggcgcgctgcgtggcggtcaccatgccg
cagcaggtttatgacgcgctggtgtcgctggcgtttaacgtcggcaccggcaacgtgtgc
gcatcaacgatggtgaaactcatcagggccagccggtggcgcgatgcctgttatcagctg
ccgcgatgggtgtacgtgaaaggcgtatttaatcaggggctggataaccggcgcgggcgc
gagctgggctggtgcctgaaaggggcggcagcatga

DBGET integrated database retrieval system