KEGG   Pantoea ananatis LMG 20103: PANA_3185Help
Entry
PANA_3185         CDS       T01195                                 

Gene name
bglA
Definition
BglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pam00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3555873..3557348
Genome map
AA seq 491 aa AA seqDB search
MLCYTHPNLILRGECIMSLPKTFLWGGAVAAHQVEGGWDQGGKGISIADVLTGGAHGVDR
VITDGVQPGKFYPNHQAVEFYSHYKQDIALFAEMGFKCFRTSIAWTRIFPNGDEPHPNEA
GLQFYDDLFDELLKYGIEPVITLSHFEMPYHLVKEYGGWHNRKVVDFFVRFSEVVLKRYK
NKVKYWMTFNEINNQRNWQYPLFGYCCSGVIFTEHEKPEQAMYQVMHHQFVASAKVVKLG
HEINPEFKIGCMIAMVPVYPFSCHPDDVMLAQEAMHQRYVFSDVQMRGYYPAYALKEWAR
KGYHIDMEPEDAETLRNGCADYVGFSYYMSTAVQTRASGVDDPITGFEGTVKNPHVKASD
WGWQIDPVGLRYVLNDVYERYQKPLFIVENGFGAIDKPNAQGVIEDDYRIDYLAAHIEEM
KKAVIHDGVDLMGYTPWGCIDCVSFTTGQYNKRYGFIHVNKNDDGSGDFSRSRKKSFAWY
QQVIASNGEKL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgctttgctacactcaccccaatttaatcctcaggggagagtgcataatgagcttacca
aaaacgtttctgtggggcggcgcggtcgcggctcatcaggtagagggcggctgggatcag
ggcggtaagggcatcagtattgctgatgtactgaccggcggcgctcatggcgtggaccgc
gtcatcaccgacggcgtccagccaggaaaattctatccaaatcatcaggctgttgaattt
tattctcattacaaacaggatatcgcgctgtttgctgagatgggatttaaatgcttccgt
acctcaattgcctggacccgtattttccctaacggcgatgaaccgcaccccaatgaagcc
ggcctgcaattctatgacgatctgtttgatgaattgcttaaatacggtattgagccggtt
attaccctctcccattttgaaatgccctatcacctggtaaaagaatacggtggctggcac
aatcgtaaggttgtcgatttctttgtgcgctttagtgaagtcgtactgaagcgttataag
aataaagtgaaatactggatgacctttaacgaaattaacaaccagcgtaactggcaatat
ccgctgtttggttactgctgctcaggcgttattttcacggaacatgaaaaacctgaacag
gcgatgtatcaggtcatgcatcaccagtttgttgccagcgccaaagtcgtgaagctgggc
cacgagatcaacccggagtttaagattggctgcatgatcgccatggtgccggtttacccc
ttctcctgccatccggatgacgtcatgctcgctcaggaagcgatgcatcaacgctatgtc
tttagcgacgtgcagatgcgcggttactacccggcttacgccctgaaagagtgggcgcgc
aaaggctatcatatcgacatggagcctgaagacgctgaaaccctgcgcaatggctgtgcc
gattatgtgggcttcagttattacatgagtacagccgttcagacccgcgccagtggcgtt
gatgatcctattaccggcttcgaaggcacggtgaaaaatccgcacgttaaagcctcagac
tggggctggcagatcgatcctgttggtctgcggtatgttcttaatgatgtgtatgaacgc
tatcagaaacccctgtttattgttgaaaacggttttggcgccatcgacaaaccgaatgcg
cagggcgtgatagaggatgattaccgcattgattatctggccgcgcatattgaagagatg
aaaaaagccgtcattcatgacggggtggatctcatggggtacacgccctggggctgtatc
gactgcgtgtctttcactaccggtcagtacaacaagcgttacggttttattcacgtgaat
aaaaacgatgacggcagcggagacttctcgcgctccaggaaaaagagttttgcctggtat
caacaggtcatcgccagcaatggtgaaaagctgtaa

DBGET integrated database retrieval system