KEGG   Pantoea ananatis LMG 20103: PANA_3233Help
Entry
PANA_3233         CDS       T01195                                 

Gene name
melA
Definition
MelA
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PANA_3233 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    PANA_3233 (melA)
   00600 Sphingolipid metabolism
    PANA_3233 (melA)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PANA_3233 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3606536..3607942
Genome map
AA seq 468 aa AA seqDB search
MMNGVTFWRYPTLQWSVLMSAPKITFIGAGSTIFVKNILGDVFHRDALKSAHIALMDIDA
TRLEESFTVVSKLMSSAGAAGRITCHTDQKAALADADFVVVAFQIGGYEPCTLTDFAVCK
RYGLEQTIADTLGPGGIMRALRTIPHLWQICEDMTAVCPDATMLNYVNPMAMNTWAMYAR
YPHIKQVGLCHSVQGTAEELAYDLNLNPADLRYRSAGINHMAFYLELERKTADGAYVNLY
PELLAAFEAAQVPKPNMHGNTRCPNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGRED
LIARYQIPLDEYPKRCVEQLDNWRTELEHYKRAERIESKPSREYASAIMNAIWTGEPAVI
YGNVRNDALIDNLPQGCCVEVACLVDANGIQPTKVGTLPSHLAAMMQTNINVQTLLTEAI
LTENPERVYHAAMLDPHTAAVLGIEEIYALVDELIAEHGDWLPAWLHK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaatggcgtgacattctggcgttatccaaccttgcaatggagcgtcctgatgtct
gcacccaaaattacctttattggcgcgggttccactattttcgtcaaaaatatccttggc
gatgtctttcaccgcgatgcgctgaaatccgcccatatcgcgttgatggatattgatgcg
acccggcttgaagagtcctttaccgtggtcagtaagctgatgagttcggctggtgcggcc
ggaagaatcacctgccacaccgaccagaaagcggcattagcggatgccgactttgttgtg
gtcgcgtttcagataggcggctatgaaccctgtaccctcactgattttgcggtgtgtaag
cgttacggtcttgagcagaccatcgccgacacgcttggcccgggcggcatcatgcgcgcg
ctgcgcaccatcccgcacctctggcagatttgtgaagacatgacggcggtatgtcctgat
gccaccatgcttaattacgttaaccccatggcgatgaacacctgggcgatgtacgcgcgt
tatccgcatatcaaacaggtcggcctgtgccattccgttcagggaacggcggaagagctg
gcttacgatctcaatcttaacccggccgatttacgttaccgctctgccggcatcaaccac
atggccttttacctggagctggagcgtaaaactgcagacggggcttatgtgaatctctac
ccggaactgcttgccgcttttgaagccgcgcaggtaccgaaacccaacatgcatggcaat
acgcgctgtcccaacattgtgcgctatgagatgttcaaaaaactgggctatttcgtcacc
gagtcttcagaacattttgcagaatatacgccctggtttatcaagccgggacgagaggat
ctgattgcgcgctaccagatcccgctggatgagtatcccaaacgctgcgtcgagcagctg
gataactggcgtaccgagcttgaacattacaagcgcgctgagcgtattgaaagcaaaccc
tcgcgcgaatatgccagcgccattatgaatgccatctggacaggtgaaccggccgtgatt
tacggcaacgtgcgtaacgatgcattaatcgacaacctgccgcagggatgctgtgttgag
gtcgcctgcctggtggacgccaacgggattcagcctacgaaggtgggaaccctgccctca
catctggcagccatgatgcaaaccaatatcaacgtgcagacactgctgaccgaagccatc
ctgaccgagaaccctgagcgggtttaccacgcggccatgctggatccccatacggcggcg
gtgctgggcatcgaggagatttatgcgctggtggatgagctgatcgccgaacacggggac
tggctgcccgcctggctgcacaaataa

DBGET integrated database retrieval system