KEGG   Pantoea ananatis LMG 20103: PANA_3300Help
Entry
PANA_3300         CDS       T01195                                 

Gene name
deoA
Definition
DeoA
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pam00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3680190..3681518)
Genome map
AA seq 442 aa AA seqDB search
MYLAQEIIRKKRDGHALSEDEIRFFINGVRDNSVSEGQIAALAMTIYFHDMSLPERVALT
MAMRDSGTVLNWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPSDDHFRQTIKQVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYEASENLAQAIVGVANGAGCRTTALLT
DMNQVLASTAGNALEVREAVRFLTGVQRNPRLLEVTLALCSEMLISGKLAENEAEAREKL
MTVLDNGKAAEVFARMVAAQKGPTDFVERYDSYLPAPTMSKAVYADRAGCVTHMDTRALG
MAVVAMGGGRQRASDAIDYSVGLSDMITLGEQVDASRPLAVIHASSEAHWQQAAAAVKAA
ITLGERAPAATPVVYRRVTEAG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccttgcacaagaaatcattcgaaaaaaacgtgacggccacgcgctgagtgaagac
gagattcgtttcttcattaacggcgtgcgtgataacagcgtttcggaaggacaaattgcc
gcgctggcaatgaccatttattttcacgatatgtcgctgccggagcgggttgccctgacg
atggcgatgcgtgactcaggcaccgtgctgaactggaaatccctgaatctgaacgggccg
gtggtcgataagcactccaccggcggcgtcggcgatgtcacctcgttgatgctggggccg
atggtggccgcctgtggcggctatatcccgatgatctcaggtcgcgggcttgggcacacc
ggcggcaccctggacaagctggaagcgattcccgggtttgacattttccccagtgatgac
cactttcgccagaccataaagcaggttggcgtggcaattattggccaaaccaactccctg
gccccggcggacaaacgcttttacgctacgcgcgacatcacggccaccgtggattcgatt
ccgctgatcaccgcctcgattctggcgaaaaagctggccgaagggctggatgcgctggtg
atggatgtcaaagtgggctccggggcatttatgcccacgtatgaagcctctgaaaacctg
gcgcaggccattgttggcgtcgccaacggcgcgggctgtcgcaccacggcgctgttaacg
gatatgaaccaggtgctggcctccacggccggtaacgcgctggaagtgcgcgaagcagtg
cgcttcctgaccggtgtgcagcgtaacccgcgcctgctggaagtcactttggcgctgtgc
agcgaaatgctgatctccggcaaactggcggaaaatgaggctgaggcacgcgaaaaactc
atgacggtgctggataacggcaaggccgcagaggtgtttgcccgcatggtggcggcgcag
aagggcccgaccgattttgttgagcgctacgacagctatttacctgcgccaacgatgagc
aaagcggtttatgccgaccgggcaggctgtgttacccatatggatacccgcgcgctgggc
atggcggtggtggcgatgggcggtggacgccagcgcgccagtgatgccatcgattacagc
gtgggcctgagcgacatgatcaccctgggcgagcaggtggatgcttcacgtccgctggcg
gtcatccatgccagcagcgaagcgcactggcaacaggccgctgccgccgtaaaagccgcg
attaccttgggtgaacgcgccccggcagccacgcctgtcgtgtatcgccgcgtcactgag
gcaggctga

DBGET integrated database retrieval system