KEGG   Pantoea ananatis LMG 20103: PANA_3493Help
Entry
PANA_3493         CDS       T01195                                 

Gene name
yihQ
Definition
hypothetical protein
Orthology
K15922  
alpha-glucosidase [EC:3.2.1.20]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pam00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pam00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3885420..3887540)
Genome map
AA seq 706 aa AA seqDB search
MAVTSTNHAKPYFLSYNAEVRMHLQHPETAGVKLTAAGNGFSLTYQNRQILSHSEEKPCL
WIGNGNADIDMFRGNFSIKDRLNEKLALTSAVVTAQDTGWTVRFSRGEVFSATLIIGTDE
NGRLLLTLTNDSDRLNRIWLRLSALDDDHIYGCGEQFSCFDLRGKPFPLWTSEQGVGRNK
KSVVTWQADCAENAGGDYYWTFFPQPTFVSSQKYYCHVDNSGYMNFDFSAADYHELAFWE
NNATLRFECADTYIALLEKMSALLGRQPVLPDWVYDGVTLGIQGGTDICQQKLDKMRQAG
VKVNGIWAQDWSGIRMTSFGKRVMWNWQWDSELYPQLDARIQQWKAEGVQFLSYINPYVA
SDRNLCEEAARKGYLTKNAAGDDYHVEFGEFYAGVVDLTNPEAYHWFKGVIKDNLIALGC
RGWMADFGEYLPTDTYLHNGVSAEIMHNAWPALWAKCNYEALEETGKLGDVLFFMRAGYT
GSQKYSVMMWAGDQNVDWSLDDGLASVVPAALSLAMSGHGLHHSDIGGYTTLYGMKRSKE
LLLRWCDFNAFTPMMRTHEGNRPGDNWQFDSDEETIAHFARMSTIFTTLKPYIKQAVAQN
AHSGLPVMRPLFLHYEADARTYTLKYQYLLGRDLLVAPVYEEGRRDWSLYLPEDRWVNMW
TGETLNGGDITVAAPMGQPPVFYRADSEWQSLFASLRLAGSQILPQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
ttggctgtgaccagcacgaatcacgctaaaccttattttttatcctacaacgcagaggtc
agaatgcatttacaacatcctgagacggcaggcgtaaagctgactgccgccggtaacggc
ttttcactgacttatcaaaaccgacagattcttagccacagcgaggaaaaaccctgtctg
tggataggcaatggcaacgccgatatcgacatgtttcgcggcaatttcagtattaaagac
cggttgaatgaaaaactggcgttaacctcggccgttgtgaccgcgcaggacaccggctgg
acggtgcgcttctcacgcggagaggtatttagcgccacgctgatcatcggcacagatgaa
aacggccgcctgttgcttacgctgacaaacgacagcgacaggcttaaccgtatctggctg
aggctgtcagccttggacgacgatcatatctacggctgtggcgagcagttttcctgtttt
gatttgcgcgggaaaccttttccactctggaccagcgaacagggcgtcgggcgcaataag
aaaagcgtggtcacctggcaggctgactgtgcagagaatgccggcggagattactactgg
acctttttcccacagccgacctttgtcagcagccagaagtattactgccatgtggataac
agcggctacatgaattttgacttcagcgcagcggattatcatgaactggctttctgggaa
aataacgccacgttacgttttgaatgtgccgatacctacatcgccctgctggaaaaaatg
agtgccctgttggggcgtcagccggtattaccggactgggtttacgatggcgtcacgctg
gggatccaaggcggcaccgacatctgccagcagaagctggacaaaatgcgtcaggcgggc
gtgaaagtgaatggcatctgggcgcaggactggtccggcatccggatgacctccttcggc
aaacgcgtgatgtggaactggcagtgggacagcgagctttatccccaactggacgcgcgc
attcagcagtggaaagcggaaggcgtacagttcctgtcttatatcaacccttacgtcgcc
agcgaccgtaacctgtgcgaagaggccgcccggaaaggatatctgaccaaaaatgcggct
ggggacgattaccacgtcgaatttggtgagttttatgcgggcgtcgtcgatctcacgaat
ccggaggcttaccactggttcaaaggcgtcatcaaagacaatctgattgccctgggctgt
cgcggctggatggcggattttggggagtacctgccaacggacacgtatctgcacaacggc
gtcagcgccgaaatcatgcacaatgcctggcccgcgctgtgggcgaagtgtaactacgag
gcgctggaagaaaccggcaaactcggtgacgtgctgttctttatgcgtgcgggttacacc
ggcagtcagaaatactccgtgatgatgtgggccggggatcaaaatgttgactggagcctg
gacgatggcctggcctcggtggtgcccgccgcgctgtcactggcgatgagcggccacggt
ttgcatcacagcgacatcggtggctacaccacgctgtacggcatgaaacgcagtaaagaa
ctgctgcttcgctggtgtgacttcaatgcttttaccccgatgatgcgcacccatgaaggg
aaccgtcctggcgataactggcagtttgacagcgatgaagaaaccattgcccactttgcc
cgcatgtccacgatcttcaccaccttaaaaccttatatcaagcaggctgtcgcgcagaat
gcccactcgggcttacccgttatgcgccctttgtttttgcactatgaagcggatgcccgc
acctacacgctcaaataccaatatctgctggggcgtgacctgctggtggcaccggtttat
gaagagggccgccgcgactggtcgctctatctgcctgaagaccgctgggtcaacatgtgg
accggagaaacgttaaacggcggggatatcactgtcgccgcgccgatggggcagccgccg
gtattttatcgggcagacagcgaatggcagtcattgtttgcttcattacggcttgctggc
agtcagatattgccacagtag

DBGET integrated database retrieval system