KEGG   Pantoea ananatis LMG 20103: PANA_3686Help
Entry
PANA_3686         CDS       T01195                                 

Gene name
ycjM
Definition
(GenBank) YcjM
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
pam  Pantoea ananatis LMG 20103
Brite
Enzymes [BR:pam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     PANA_3686 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADD78853
UniProt: D4GD28
Position
4074768..4076459
Genome map
AA seq 563 aa AA seqDB search
MIMEKITALIDKIYADAFPQAMRERLLATIVEARDTTKLPRKVHWDEQDVVLITYADQFR
EPGKPTLNTFSRFYQQHLHATFPLVHLLPFYPYSSDDGFSVVNYHQVDPLCGDWQDIALL
HQETRLMFDFVCNHMSAHSAWFKHYLAQDEGWDDFFISLPPTTDLSAVTRPRTSPLLTPF
TLENGGIRFVWTTFSADQIDLNFARPRVLVRMVEVLLDYLKRGADYVRLDAVGYMWKTPG
TNCIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNISYFGNGQDEAQMVYQFSLP
PLVLHAIHTGSARALRQWASTLQVGNGDTTFFNFLASHDGIGLNPARGILSEVEITALVR
DLALEGALISYKNNPDGSTSPYEINVTYFDALNREGDDDETRLKRFMLAHAILLAFPGVP
AVYIQSILGSRNDYDGVREAGHNRAINRQKYSLSAIEDALVNSDGLRHQVYTRLSKLIQQ
RRRQTAFHPDNPLTLFQSDNALLIMKRYSHNGGDELLCVFNLSGRQIEAPLPEEHLFQDV
VSGEKIDGTQPVTLDAWQFMWLR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
ttgataatggaaaagatcactgctttaatcgataagatttatgccgatgcctttcctcag
gctatgcgcgaacgcctgctcgccacgatcgttgaagcccgtgacaccactaagctgccg
agaaaggtccactgggatgagcaggacgtggtgctgattacgtatgccgatcagttccgc
gagccgggcaaacccacactcaacaccttttcacgtttctaccagcagcatttgcacgcc
acgtttccgctggtgcacctcctgccgttttatccctattcgtctgacgacggcttttcg
gtcgttaactaccatcaggtcgatccgctgtgtggcgactggcaggacattgccttactg
catcaggaaacgcgcctgatgttcgactttgtctgtaaccatatgtcagcgcatagtgcg
tggtttaaacattatcttgctcaggatgaaggctgggatgatttttttatcagcctgccg
cctaccaccgacctcagcgcggtcacgcggccacgaacgtcaccgttgctcacccccttt
acgctggaaaacggtggaatccgctttgtctggaccacgttcagtgccgatcagattgac
cttaactttgcccgtcccagggtgctggtgcgcatggtagaggtactactcgactatctg
aaacgtggcgcggactatgtgcgactggatgcggtgggatacatgtggaaaacgccaggc
acgaactgtattcacctcgaaaaaacgcatctgctggtcaaactgtttcgtgccattgcc
gacgtggtcgcacccggcaccgtcatcatcaccgaaacgaatgtgccgcacaaagacaac
atcagctactttggaaacgggcaagacgaagcccagatggtgtatcagttttccctgccg
ccgctggtgctacatgccatccacaccggatcggctcgcgctctgcgtcaatgggccagc
accctgcaggtgggcaatggcgatacaaccttttttaacttcctggcctcgcacgatggt
ataggtcttaatccggcacgcgggattttatcggaggtggagatcacggcgctggtgcgc
gatctggcactggagggggcgctgatctcttataaaaacaatcctgacggcagcaccagc
ccatacgaaatcaacgtgacctatttcgacgcgcttaaccgtgaaggcgatgacgacgaa
acgcgcctcaaacgctttatgctggcgcatgctattttactggcctttccgggtgttcca
gccgtctatattcaaagcatcctgggatcgcgtaatgactatgacggcgtacgtgaggca
ggccataaccgggccattaaccggcaaaaatattcgctctccgctatcgaagacgcactg
gtgaacagcgacggcttacgccatcaggtttatacccggctgagcaaactgattcagcag
cgtcgacgccagacggcctttcatcccgacaacccgttgacgttgtttcagagcgataat
gccctgctcatcatgaagcgttattcgcataacggcggtgatgaattactgtgtgtgttt
aatctcagtggcaggcagattgaagccccgttaccggaggagcatctttttcaggatgtg
gtaagcggtgagaaaattgatggcacccagccagtaacgctggatgcctggcaattcatg
tggctacgataa

DBGET integrated database retrieval system