KEGG   Pantoea ananatis LMG 20103: PANA_3691Help
Entry
PANA_3691         CDS       T01195                                 

Gene name
malQ
Definition
MalQ
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PANA_3691 (malQ)
Enzymes [BR:pam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PANA_3691 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4079062..4081134)
Genome map
AA seq 690 aa AA seqDB search
MKSTSLDKAAQAAGIALTYFDANGEPEAISDDTKRALLGIMENPQKAAKSPLPPVVVFSG
NRKRELTPQMDGSFRWQLQTEKGKTLSGTLEGGAPFKLPSPLGQGYHQLTLSKGKREWQT
RVIVTPRRCYLPPALRAGEKRWGALVQLYTVRSEKNWGIGDFGDLEMLLEQLAARGGDFV
GLNPLHALYPSSPAFASPYSPSSRRWLNIIYIDVAQVADFQQSSAGQKWWKSAKTQKALK
QARESEWVDYDAVMALKITALRHGWARFQSRDAQDAQKQQFADFIQQGGDSLRYQAAYEG
LQAEMQGKGATHAGWPAWPERWRNSQSSDVQDWCVQHADEIAFWQWLQWLAQQQFSQCWA
RSQALGMSVGLYRDLAVGVAEGSAETWHDPELYRLKASIGAPPDRLGPLGQNWGLPPMDP
HVLQARGYQPFIDILRANMRDCGALRIDHVMALLRLWWVPAGETADKGAYVAYPVHDLLG
ILALESQRLRCMVIGEDLGTVPKEIVSLLRDSGVFSWKVLWFEQEKQGNYRAPRPIHASP
LPAPVRTIFPRLTGFWSAGDLELGEKIGLYPDGQTVQNLQQQRMKQKQALLDALHKAGAV
PSRSAKRADALAMTAELNQSVHRFLADTNSALLGLQPEDWLGMTTPVNVPGTVDQYPNWR
RKLAQPLERIFTDDNVNKLLETVTKRRKAG
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccacttcacttgataaagccgcccaggcggcgggaatagcgctcacgtatttc
gatgcgaacggtgaacctgaagccatcagcgatgataccaaacgcgccttactgggcata
atggaaaacccacagaaagccgctaaatctccgctgccacccgttgtggtttttagcggt
aatcgtaaacgcgagctgacgcctcagatggacggcagcttccgctggcagttgcagaca
gagaaaggcaaaacccttagcggaaccctcgaaggcggtgcgccctttaaactgccttcg
cctctggggcagggttatcaccagctgaccttgagcaagggcaagcgtgagtggcagacg
cgcgtgatcgtgacaccgcgccgttgttatctgccaccggccttgcgcgccggagagaaa
cgctggggggcgctggttcagctttataccgtgcgttcagagaaaaactggggcatcggt
gattttggcgatctggaaatgttgctggagcagcttgccgcacgcggcggcgactttgtt
ggcctgaacccgttgcatgcgctctatccgtccagccccgcttttgccagcccctacagc
ccttcatcgcgccgctggctgaatattatttacatcgatgtggcacaggttgccgatttc
caacaaagcagcgcgggtcagaagtggtggaaaagtgccaaaactcaaaaggcgttaaag
caagcccgtgaaagcgaatgggtggattatgacgcggttatggcactgaaaattacggca
ttacgtcacggctgggcccggttccagtcgcgtgatgcgcaagacgcacagaagcagcag
tttgcggatttcatccagcaggggggcgacagcctgcgctatcaggcggcctatgagggt
ctgcaggctgaaatgcaggggaaaggtgccacgcacgcgggctggccggcctggcctgag
cgctggcgtaacagtcagtcttctgacgttcaggattggtgcgtgcagcacgcggatgag
attgccttctggcagtggttacagtggctggcacagcagcagttctctcagtgttgggca
cggagccaggcgctgggcatgagcgtggggctgtatcgtgatttagcggtcggtgtggcc
gaaggcagtgccgaaacctggcacgatccggagctgtaccgccttaaggcatcaattggc
gcgccgcctgacaggctggggccgttggggcaaaactgggggctgccgccaatggatcct
cacgtcttgcaggccaggggctatcaaccatttattgatatcctgcgcgccaatatgcgt
gactgcggggcgctgcgtattgaccacgtcatggctctgctgcgcctctggtgggttccg
gcaggtgaaacggcggataaaggcgcctacgtcgcttaccctgtgcacgatctgcttggc
attctggcgctggaaagccagcgtttgcgctgtatggtgattggtgaggatctcggtacg
gtacctaaagagatcgtcagcctgctgcgcgacagcggcgtgttttcctggaaagttttg
tggtttgagcaggaaaaacaggggaattaccgtgcccccaggcctatccacgccagtcca
ttgccagcgccagtacgcacgatcttcccacgtttgaccggcttctggagtgcaggtgat
ttagagcttggcgagaaaatcgggctttatccagacgggcaaacggtacagaacctgcag
cagcagcggatgaagcaaaaacaggccttactggatgctctgcataaagcgggagccgta
ccgtcgcgcagcgcaaagcgggcggatgctctggcgatgacggccgaactgaatcagtcc
gttcaccgttttctggcggacacgaacagtgcgctgctggggctacagccggaagactgg
ctggggatgacgacgccggtgaatgtgccgggaacggtcgaccaatatcccaactggcgg
cgcaagctcgcgcagccgctggaacgcatttttaccgacgataacgtgaataaactgctg
gaaaccgtgactaaacgacgcaaggcaggataa

DBGET integrated database retrieval system