KEGG   Pantoea ananatis LMG 20103: PANA_3866Help
Entry
PANA_3866         CDS       T01195                                 

Gene name
tpiA
Definition
TpiA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA_3866 (tpiA)
   01230 Biosynthesis of amino acids
    PANA_3866 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_3866 (tpiA)
   00051 Fructose and mannose metabolism
    PANA_3866 (tpiA)
   00562 Inositol phosphate metabolism
    PANA_3866 (tpiA)
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PANA_3866 (tpiA)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PANA_3866 (tpiA)
  Exosomal proteins of bladder cancer cells
   PANA_3866 (tpiA)
  Exosomal proteins of melanoma cells
   PANA_3866 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4288291..4289136
Genome map
AA seq 281 aa AA seqDB search
MISILSGRQRCPGAAPFHVSRYAEDRMRHPLVMGNWKLNGSKHMTAELIDGLRKELSGVE
GCGVAIAPPALYLDQAKHAISGSHIALGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIG
HSERRTYHKESDEFIAKKYAVLKTAGLVPVLCIGETEAENEAGKTEEVCARQLDAVLTTQ
GAEAFKDAIIAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVN
DKNAAELFTQPDIDGALVGGASLKADAFAVIVKAAAAAKQR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgatctctatactgtctggcagacaacgttgccccggggcagcgccatttcatgtatcg
cgttatgcggaggatagaatgcgacatccactggttatgggtaactggaagttgaatggc
agcaagcatatgacagccgaactgatcgacggtctgcgcaaagaactgtcgggcgttgag
ggttgtggcgtcgctattgcaccgcccgcgctctatcttgatcaggctaaacacgccatc
tccggtagccacatcgctctgggtgctcaaaacgttgatgtaaacctctctggcgcattt
accggcgaagtgtccgctgaaatgctgaaagatatcggcgcgaaatacatcatcattggt
cactcagaacgtcgcacttatcacaaagagagtgacgagttcattgcgaaaaaatatgcc
gtgttgaaaactgctggcctggtgccggttctgtgcatcggtgaaactgaagcggaaaac
gaagcgggcaaaaccgaagaagtgtgtgcacgccagcttgatgcggtgctgaccactcag
ggtgcagaagcgttcaaagatgcgatcatcgcttacgagccggtatgggcgatcggtacc
gggaagtcagccacacctgctcaggcgcaggcagttcacaaatttattcgtgaccacatt
gccaaaaaagatgcggctatcgctgagcaagtgattattcagtacggcggctcagttaac
gataaaaacgctgccgagctgtttactcagccggacatcgacggtgccctggttggcggc
gcgtcgctgaaagccgatgcgtttgccgtgatcgttaaagctgctgcggcggctaaacaa
cgctaa

DBGET integrated database retrieval system