KEGG   Pantoea ananatis LMG 20103: PANA_3901Help
Entry
PANA_3901         CDS       T01195                                 

Gene name
mutM
Definition
MutM
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pam03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4321872..4322699)
Genome map
AA seq 275 aa AA seqDB search
MRRGEVMPELPEVETSRRGIEPHLVGQTILHAVVRNARLRWPVSQEILALSDQPVLSVQR
RAKYLLLELPHGWIIIHLGMSGSLRVLSEELPAAKHDHVDLVMSNGKVLRYTDPRRFGAW
LWSSDLAGSSVLAHLGPEPLSEAFSGDYLFEKSRGKRTVIKQWLMDNKIVVGVGNIYASE
SLFTAGIIPDRPAMSLSHEDAAILANTIKAVLLRSIEQGGTTLRDFLQSDGKPGYFAQEL
QVYGRAGEPCRACGTPIVSGKHGQRSTYWCPNCQH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggggagaggttatgcctgagttgccagaggtagaaaccagccgacgcggcatt
gagccacatctggttggtcagacaattcttcacgcagtcgtgcgcaatgcgcgtttgcgt
tggccagtgtcacaagaaatcctggcgttaagcgatcagcctgtgctgagcgttcaacgt
cgtgccaaataccttttactcgaattgccgcacggctggattattatccacctgggtatg
tcaggcagtttacgtgtcctttcagaagagttgcccgcagccaaacacgatcatgtcgac
ctggtcatgagcaacggtaaagtcctgcgctataccgatccccggcgttttggcgcctgg
ctgtggagcagcgacctggccggcagtagcgtactggcacacctcggcccagagccgctg
agtgaagcgttcagtggtgactatctgtttgaaaaatcccgcggaaagcgaacggtgatt
aagcagtggctaatggacaataaaattgtcgttggcgtgggtaacatctatgcgagtgag
tcactgtttacggcagggatcattcctgatcgacccgcaatgagcctttcccatgaagat
gcggcgatattagcgaataccatcaaagcggtactgctgcgctcaatcgagcagggcgga
acaacattacgcgactttttacaaagtgatggcaaaccgggctattttgcacaagagcta
caggtttatggtcgcgcgggagagccctgcagagcatgtggcacaccgattgtcagtggc
aagcatgggcaacgcagcacttactggtgccccaactgtcaacactaa

DBGET integrated database retrieval system