KEGG   Pantoea ananatis LMG 20103: PANA_3936Help
Entry
PANA_3936         CDS       T01195                                 

Gene name
gmk
Definition
Gmk
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pam00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4351827..4352501
Genome map
AA seq 224 aa AA seqDB search
MYTVQETDSALNQFKKIMAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRG
MRPGEAHGEHYFFVQQHEFEKMIAEDAFLEHAKVFDNYYGTSRKAIEQVLATGVDVFLDI
DWQGAQQIRAKMPEARSIFVLPPSKEELDRRLRGRGQDSEEVIARRMAQAVAEMSHYAEY
DYLIVNDDFDLALSDLKTIIRAERLRMARQKARHDALISKLLAV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgtatactgtgcaggaaaccgactccgcacttaatcaattcaagaaaatcatggcccaa
ggtacgctctatattgtttctgcgcccagtggtgcaggaaaatccagtctgattcaggca
ctgttaaaaacgcagccgctgtatgatacgcaagtgtctgtttcccataccacccgtggt
atgcgtccgggcgaagcgcatggtgaacattacttctttgttcaacagcatgagttcgaa
aaaatgatcgcggaagatgcttttctggagcacgcgaaagttttcgacaactattacggc
acctcgcgtaaggcaattgaacaggtcctggcgaccggcgtggacgtttttcttgatatt
gactggcagggcgcgcagcaaattcgcgctaagatgccagaagcgcgcagcatatttgtc
ttgccgccttcgaaagaagaactggatcgtcgcctgcgtggtcgcggtcaggacagcgaa
gaggtcattgcgcgtcggatggcacaggccgtggcagaaatgagccactacgccgaatac
gactatttaattgtgaatgatgattttgatctggcgttatcggatctgaaaaccattatt
cgcgcagaacgtctgcgcatggcccgtcagaaagcgcgccatgatgctttaatcagcaaa
ctgttggcagtctga

DBGET integrated database retrieval system