KEGG   Pantoea ananatis LMG 20103: PANA_3936Help
Entry
PANA_3936         CDS       T01195                                 

Gene name
gmk
Definition
(GenBank) Gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam01100  Metabolic pathways
Module
pam_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PANA_3936 (gmk)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PANA_3936 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_18 AAA_33 ABC_tran CPT AAA_22 AAA_35 MMR_HSR1 AAA_29 Dynamin_N Viral_helicase1 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: ADD79103
UniProt: D4GEJ7
Position
4351827..4352501
Genome map
AA seq 224 aa AA seqDB search
MYTVQETDSALNQFKKIMAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRG
MRPGEAHGEHYFFVQQHEFEKMIAEDAFLEHAKVFDNYYGTSRKAIEQVLATGVDVFLDI
DWQGAQQIRAKMPEARSIFVLPPSKEELDRRLRGRGQDSEEVIARRMAQAVAEMSHYAEY
DYLIVNDDFDLALSDLKTIIRAERLRMARQKARHDALISKLLAV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgtatactgtgcaggaaaccgactccgcacttaatcaattcaagaaaatcatggcccaa
ggtacgctctatattgtttctgcgcccagtggtgcaggaaaatccagtctgattcaggca
ctgttaaaaacgcagccgctgtatgatacgcaagtgtctgtttcccataccacccgtggt
atgcgtccgggcgaagcgcatggtgaacattacttctttgttcaacagcatgagttcgaa
aaaatgatcgcggaagatgcttttctggagcacgcgaaagttttcgacaactattacggc
acctcgcgtaaggcaattgaacaggtcctggcgaccggcgtggacgtttttcttgatatt
gactggcagggcgcgcagcaaattcgcgctaagatgccagaagcgcgcagcatatttgtc
ttgccgccttcgaaagaagaactggatcgtcgcctgcgtggtcgcggtcaggacagcgaa
gaggtcattgcgcgtcggatggcacaggccgtggcagaaatgagccactacgccgaatac
gactatttaattgtgaatgatgattttgatctggcgttatcggatctgaaaaccattatt
cgcgcagaacgtctgcgcatggcccgtcagaaagcgcgccatgatgctttaatcagcaaa
ctgttggcagtctga

DBGET integrated database retrieval system