KEGG   Pantoea ananatis LMG 20103: PANA_4017Help
Entry
PANA_4017         CDS       T01195                                 

Definition
(GenBank) Hypothetical Protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00520  Amino sugar and nucleotide sugar metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pam_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_4017
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_4017
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     PANA_4017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADD79184
UniProt: D4GES8
Position
complement(4457562..4458257)
Genome map
AA seq 231 aa AA seqDB search
MTRQTKKKKDHVVLSIDIGGSHVKILSSTGGVKKKADSGKNMSAADMVAAVKTLAEGMSY
DVIAMGFPGPVADNKPIREPANLGEGWVGFDYAGAFGCPVRIVNDALMQALGSYQGGRML
FLGLGTGLGAAMIIENVAQPMEIAHLPYRKGNSYEHYVGEAYRVKKGNKKWQARVFDVVE
MLTTALQPDYVVLGGGNVDELDSLPPKCRKGDNTLAFEGGFRLWNDPRLIT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggcaaactaaaaaaaagaaagatcatgttgttttgtccatcgacatcggcgga
agccatgtgaagatcctctccagcactggcggggtaaaaaagaaggcagatagtggaaaa
aacatgtcggccgcagacatggttgccgcggttaagaccctggcggaaggcatgtcctat
gatgtgattgcgatgggatttccgggtcccgtcgcggacaataaacccattcgggagccc
gccaacctcggtgagggctgggtggggtttgactatgcaggcgcatttggctgccctgtt
cgtatcgtcaacgacgccctgatgcaggcgctgggttcctatcagggcggacgcatgctg
ttcctcggtcttggcacgggactaggggctgcgatgatcatcgaaaacgtcgctcagccc
atggagatcgctcacttaccttatcgcaaaggcaatagctacgaacactacgtaggtgaa
gcctaccgggtaaaaaaggggaacaaaaaatggcaggcgcgggtttttgacgtggtggaa
atgctgaccaccgcgttgcagcctgactacgtggttttaggcggaggaaacgtagatgaa
cttgactcactcccgccaaagtgccggaaaggcgacaacacactggcattcgagggggga
tttcgtctctggaacgatccgagattaattacttga

DBGET integrated database retrieval system