KEGG   Pantoea ananatis LMG 20103: PANA_4153Help
Entry
PANA_4153         CDS       T01195                                 

Gene name
glsA1
Definition
GlsA1
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pam00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pam00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:pam00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4615642..4616562
Genome map
AA seq 306 aa AA seqDB search
MTTLSNTLLEAVLEQVRPLVHQGKVANYIPALADVAADHLGIAVCLRDGTVFQAGDAETR
FSIQSISKVLSLTVALTRYEDAEIWRRVGKEPSGQPFNSLVQLELEQGKPRNPFINAGAL
VICDLLETRLTAPRQRMLEIIRQLSQQSDIQYDRHVARSEYEHSARNAAIAWLMKSFGNF
DNDVTSVMQTYFHYCSLSMNCIELARSFIYLANQGKTLDGASLISSRQARQINALMITSG
MYDGAGEFAWRVGMPAKSGVGGGIIAVIPGEMSIAVWSPGLDSAGNSLAGTAALECLTDK
LGRSIF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactctcagtaatacactgctcgaagccgttcttgagcaggtccgtccgttagtt
catcagggcaaagtcgctaattacattccggcgctggctgacgtcgcggccgaccatctg
ggtatagcggtctgtttacgtgatggcacagtttttcaggcaggcgatgctgaaacacgt
ttttcgatccagtccatttcgaaagtgctctctctcaccgtcgcgctgacgcgttatgag
gatgcggagatatggcggcgagtgggtaaagaaccctccggtcagccttttaattcgctg
gttcagcttgaactggagcagggaaaaccccgtaatccctttattaacgccggggcgctg
gtgatctgcgatttgcttgaaacccggctgacagcaccgcgtcagcgtatgctggaaata
atccgtcagctcagtcagcaatcggatattcagtacgatcgtcacgtcgcccgttctgaa
tacgaacactctgcccgcaacgcggctatcgcctggctgatgaagtcatttggtaatttt
gacaacgacgtcaccagcgttatgcagacttattttcactactgctcattgtccatgaac
tgtattgaactggctcgcagttttatttatctggctaatcagggaaaaaccctggatggc
gcgtccctgatttcgtcccgccaggcgcggcagatcaatgcgctaatgattaccagcggt
atgtacgacggggctggcgaatttgcctggcgggtgggcatgcccgccaaatccggggtt
ggcggcggtatcattgctgtcattcccggtgaaatgagcatcgcggtctggtcacccgga
ttggatagcgcgggcaattcgttagccggcaccgccgcgctggagtgcctgactgacaaa
ctcggccgttcgatattctga

DBGET integrated database retrieval system