KEGG   Paracoccus aminophilus: JCM7686_0151Help
Entry
JCM7686_0151      CDS       T02792                                 

Definition
flavin monoamine oxidase-related protein (EC:1.4.3.4)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
pami  Paracoccus aminophilus
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JCM7686_0151
   00330 Arginine and proline metabolism
    JCM7686_0151
   00340 Histidine metabolism
    JCM7686_0151
   00350 Tyrosine metabolism
    JCM7686_0151
   00360 Phenylalanine metabolism
    JCM7686_0151
   00380 Tryptophan metabolism
    JCM7686_0151
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     JCM7686_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87106..88692
Genome map
AA seq 528 aa AA seqDB search
MSEISTGMTRRNLLAMVGIAAGASAMYSAMAGMGYAGASDYKGPLKLEGDPKGTSVLILG
AGLAGMTAAYELRNAGYKVQVLEYREKAGGRCWTLRGGDVFTELGGFKQEVKFAEGNYLN
PGPWRIPSDHYAVLDYCKRFGVKLEPFIQQNYNAYLHNTNAFGGKPQRFKEIQADYRGQI
SELLAKAVDQKKLDELVTEEDAALLIESLKKYGVLNDKMEYVKSDDVSGYRGWEKDPGGG
VDSAGVPSDIISLSDILKGRLWNDLITGESIDHQAAIFQPIGGMDMIAQGFEKEVKDLIT
YNVKVIKIEGGENGVTATYVDSNGGTEEKTAKADYCICTIPFSVLGQIDHNFSSDMTAAI
EDVYYASSVKVGLEFKRRFWEQDEHIYGGISYTNTPITLISYPSTNFFSDGPGVLLAAYS
WGAASYQFNAVPAEERIEKALEFGAEIHPQYREEFSNGVGVGWHRVPWTLGCYGVWRDMD
AHYDNACKMDQRTLMAGEHISHLPAWQEGAILSALDAIQRLHKHVTGA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatttccacgggaatgacgaggcgtaacctcctggcgatggtgggcatcgct
gctggcgcatccgcaatgtatagcgcgatggccgggatgggttacgctggggcgtccgac
tacaagggccccttgaagttggaaggcgatcccaagggcacctctgtcctgatcctgggt
gctggtcttgccggcatgaccgccgcctatgagctgcgcaatgcgggttataaggtccag
gttctggaatatcgcgaaaaggccggtggccgttgctggaccctgcggggcggcgatgtg
ttcaccgaactcggtggcttcaagcaggaagtcaaattcgccgagggcaactacctgaac
cccggcccgtggcgcattccgtcggaccactatgcggttctggactattgcaagcgcttt
ggcgtcaagctcgagcccttcattcagcagaactacaacgcctatctgcacaacaccaat
gcctttggtggcaagccgcagcgcttcaaggaaatccaggcggattaccggggccagatt
tccgagcttctggcgaaagctgtcgaccagaagaaactcgacgagctcgtgaccgaagaa
gacgcagcgctcctgatcgagtcgctgaagaaatacggcgtgctgaacgacaagatggaa
tatgtgaagtcggacgacgtgtcgggctatcgcggctgggaaaaagatccgggcggcggt
gtcgattcggccggcgttccctcggacatcatctcgctctcggacatcctcaagggccgt
ctgtggaacgatctgatcaccggcgagtcgattgaccaccaagcggcgatcttccagccg
atcggcggcatggacatgatcgctcagggcttcgagaaagaagtcaaagatctgatcacc
tataacgtcaaggtcatcaagatcgagggcggcgaaaacggcgtcaccgcgacctatgtc
gattcgaacggcggcaccgaagagaaaaccgccaaggccgattactgcatctgcaccatt
cccttctcggtgctgggtcagatcgaccacaacttcagctcggacatgaccgcggccatc
gaggacgtttactacgcctcctcggtcaaagtcggtctcgagttcaagcgtcgcttctgg
gaacaggacgagcatatctacggcgggatttcctacacgaataccccgatcacgctcatc
tcctatccctcgaccaacttcttcagcgatggtccgggcgttctgctggcggcttattcc
tggggtgcggcctcgtatcagttcaacgcggttcccgcggaagagcggatcgagaaagcc
ctcgaattcggcgccgagatccacccgcagtatcgcgaagagttctcgaacggcgtgggc
gttggctggcaccgcgtgccgtggacgctgggttgctacggcgtctggcgcgacatggat
gcgcattacgacaatgcctgcaagatggaccaacgcacgctgatggcgggcgaacacatc
tcgcacctgccggcatggcaggaaggcgcgatcctgtcggctctggatgcgatccagcgt
ctgcacaagcatgtcaccggcgcgtga

DBGET integrated database retrieval system