KEGG   Paracoccus aminophilus: JCM7686_0151Help
Entry
JCM7686_0151      CDS       T02792                                 

Definition
(GenBank) flavin monoamine oxidase-related protein
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
pami  Paracoccus aminophilus
Pathway
pami00260  Glycine, serine and threonine metabolism
pami00330  Arginine and proline metabolism
pami00340  Histidine metabolism
pami00350  Tyrosine metabolism
pami00360  Phenylalanine metabolism
pami00380  Tryptophan metabolism
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JCM7686_0151
   00330 Arginine and proline metabolism
    JCM7686_0151
   00340 Histidine metabolism
    JCM7686_0151
   00350 Tyrosine metabolism
    JCM7686_0151
   00360 Phenylalanine metabolism
    JCM7686_0151
   00380 Tryptophan metabolism
    JCM7686_0151
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     JCM7686_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Thi4 Pyr_redox_2 FAD_binding_3 Pyr_redox HI0933_like DAO AlaDh_PNT_C GIDA FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGT07262
UniProt: S5XQD2
Position
87106..88692
Genome map
AA seq 528 aa AA seqDB search
MSEISTGMTRRNLLAMVGIAAGASAMYSAMAGMGYAGASDYKGPLKLEGDPKGTSVLILG
AGLAGMTAAYELRNAGYKVQVLEYREKAGGRCWTLRGGDVFTELGGFKQEVKFAEGNYLN
PGPWRIPSDHYAVLDYCKRFGVKLEPFIQQNYNAYLHNTNAFGGKPQRFKEIQADYRGQI
SELLAKAVDQKKLDELVTEEDAALLIESLKKYGVLNDKMEYVKSDDVSGYRGWEKDPGGG
VDSAGVPSDIISLSDILKGRLWNDLITGESIDHQAAIFQPIGGMDMIAQGFEKEVKDLIT
YNVKVIKIEGGENGVTATYVDSNGGTEEKTAKADYCICTIPFSVLGQIDHNFSSDMTAAI
EDVYYASSVKVGLEFKRRFWEQDEHIYGGISYTNTPITLISYPSTNFFSDGPGVLLAAYS
WGAASYQFNAVPAEERIEKALEFGAEIHPQYREEFSNGVGVGWHRVPWTLGCYGVWRDMD
AHYDNACKMDQRTLMAGEHISHLPAWQEGAILSALDAIQRLHKHVTGA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatttccacgggaatgacgaggcgtaacctcctggcgatggtgggcatcgct
gctggcgcatccgcaatgtatagcgcgatggccgggatgggttacgctggggcgtccgac
tacaagggccccttgaagttggaaggcgatcccaagggcacctctgtcctgatcctgggt
gctggtcttgccggcatgaccgccgcctatgagctgcgcaatgcgggttataaggtccag
gttctggaatatcgcgaaaaggccggtggccgttgctggaccctgcggggcggcgatgtg
ttcaccgaactcggtggcttcaagcaggaagtcaaattcgccgagggcaactacctgaac
cccggcccgtggcgcattccgtcggaccactatgcggttctggactattgcaagcgcttt
ggcgtcaagctcgagcccttcattcagcagaactacaacgcctatctgcacaacaccaat
gcctttggtggcaagccgcagcgcttcaaggaaatccaggcggattaccggggccagatt
tccgagcttctggcgaaagctgtcgaccagaagaaactcgacgagctcgtgaccgaagaa
gacgcagcgctcctgatcgagtcgctgaagaaatacggcgtgctgaacgacaagatggaa
tatgtgaagtcggacgacgtgtcgggctatcgcggctgggaaaaagatccgggcggcggt
gtcgattcggccggcgttccctcggacatcatctcgctctcggacatcctcaagggccgt
ctgtggaacgatctgatcaccggcgagtcgattgaccaccaagcggcgatcttccagccg
atcggcggcatggacatgatcgctcagggcttcgagaaagaagtcaaagatctgatcacc
tataacgtcaaggtcatcaagatcgagggcggcgaaaacggcgtcaccgcgacctatgtc
gattcgaacggcggcaccgaagagaaaaccgccaaggccgattactgcatctgcaccatt
cccttctcggtgctgggtcagatcgaccacaacttcagctcggacatgaccgcggccatc
gaggacgtttactacgcctcctcggtcaaagtcggtctcgagttcaagcgtcgcttctgg
gaacaggacgagcatatctacggcgggatttcctacacgaataccccgatcacgctcatc
tcctatccctcgaccaacttcttcagcgatggtccgggcgttctgctggcggcttattcc
tggggtgcggcctcgtatcagttcaacgcggttcccgcggaagagcggatcgagaaagcc
ctcgaattcggcgccgagatccacccgcagtatcgcgaagagttctcgaacggcgtgggc
gttggctggcaccgcgtgccgtggacgctgggttgctacggcgtctggcgcgacatggat
gcgcattacgacaatgcctgcaagatggaccaacgcacgctgatggcgggcgaacacatc
tcgcacctgccggcatggcaggaaggcgcgatcctgtcggctctggatgcgatccagcgt
ctgcacaagcatgtcaccggcgcgtga

DBGET integrated database retrieval system