KEGG   Paracoccus aminophilus: JCM7686_0317Help
Entry
JCM7686_0317      CDS       T02792                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pami  Paracoccus aminophilus
Pathway
pami00071  Fatty acid degradation
pami00072  Synthesis and degradation of ketone bodies
pami00280  Valine, leucine and isoleucine degradation
pami00310  Lysine degradation
pami00362  Benzoate degradation
pami00380  Tryptophan metabolism
pami00620  Pyruvate metabolism
pami00630  Glyoxylate and dicarboxylate metabolism
pami00640  Propanoate metabolism
pami00650  Butanoate metabolism
pami00900  Terpenoid backbone biosynthesis
pami01100  Metabolic pathways
pami01110  Biosynthesis of secondary metabolites
pami01120  Microbial metabolism in diverse environments
pami01130  Biosynthesis of antibiotics
pami01200  Carbon metabolism
pami01212  Fatty acid metabolism
pami02020  Two-component system
Module
pami_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    JCM7686_0317
   00630 Glyoxylate and dicarboxylate metabolism
    JCM7686_0317
   00640 Propanoate metabolism
    JCM7686_0317
   00650 Butanoate metabolism
    JCM7686_0317
  Lipid metabolism
   00071 Fatty acid degradation
    JCM7686_0317
   00072 Synthesis and degradation of ketone bodies
    JCM7686_0317
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JCM7686_0317
   00310 Lysine degradation
    JCM7686_0317
   00380 Tryptophan metabolism
    JCM7686_0317
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JCM7686_0317
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JCM7686_0317
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    JCM7686_0317
Enzymes [BR:pami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JCM7686_0317
Exosome [BR:pami04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JCM7686_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGT07426
UniProt: S5YQ64
Position
265758..266939
Genome map
AA seq 393 aa AA seqDB search
MSENEIVILSGARTAIGAFGGSLAGVTPIELATTVTKAALERAGVSPEKIGTVVFGHVLN
TEPRDMYLSRVAMLDAGVPNTTPAMNVNRLCGSGVQAIVSAVQALTLGDADFAVAGGAES
MSRAPYTVPAARFGAKMGDVKMVDMMVGALTCPMGTGHMGVTAENVSKENEISREAQDAF
ALESQTRAAKAIAEGRFKDQIVPIEIKTRKGVVAFDTDEHPKATDLEKLAALRPAFQKDG
TVTAGNASGLNDGAGAIVLARADAAKAAGLTPKFRVLGYAVAGVRPEVMGIGPIPAVEAV
LKKTGLTAADFDVIESNEAFAAQALAVNKGLGLDPAKVNPNGGAIALGHPIGATGAIITV
KAMYELERTQGKKALITMCIGGGQGIALAIERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaatgaaatcgtcatcctgtcgggcgcgcgcacggccatcggcgctttcggc
ggcagccttgcgggagtgacgccgatcgagcttgcgacgacggtgaccaaggccgcgctc
gagcgcgctggggtttcgcccgagaaaatcggcacggtggttttcggccatgttctgaac
accgagccgcgcgacatgtatctcagccgcgtggcgatgctggacgcgggcgtgccgaac
acgacgccggcgatgaacgtgaaccggctctgcggctcgggcgtgcaggcgattgtctcg
gccgtgcaggcgctgacgcttggcgacgccgatttcgccgtggccggcggcgcagaatcc
atgagccgcgcgccctatacggtgcccgcggcgcgcttcggtgcgaaaatgggcgatgtg
aagatggtcgatatgatggtcggcgcgctgacctgcccgatgggcaccggccatatgggc
gtgacggcggaaaacgtctcgaaagagaacgagatctcgcgcgaggcgcaggatgctttc
gcgctggaaagccagacccgcgccgccaaggcgattgccgagggccggttcaaggaccag
atcgtcccgatcgagatcaagacccgcaagggcgtcgtggcctttgacaccgacgagcat
cccaaggcgaccgatctcgagaagctcgcggcactgcgcccggccttccagaaggacggc
accgtgacggcgggcaatgcctcggggctgaacgatggcgcgggcgcgatcgtgctggcg
cgggcggatgcggcgaaagcggcggggctcacgccgaaattccgcgtgctcggctatgcg
gtcgcgggcgtgcgtcccgaagtcatgggcatcggcccgatcccggcggtcgaggcggtg
ctgaagaaaaccggcctgaccgctgccgatttcgacgtgatcgaatcaaacgaggctttc
gcggcgcaggctctggcggtgaacaagggcctcggcctcgatccggccaaggtgaacccg
aatggcggcgcgatcgcactgggccatccgatcggcgcgaccggcgcgatcatcaccgtc
aaggcgatgtatgaactggaacggacccaaggcaagaaagccctgatcaccatgtgcatc
ggcggcggacagggcatcgctctggcaatcgagcgcatctga

DBGET integrated database retrieval system