KEGG   Paracoccus aminophilus: JCM7686_2134Help
Entry
JCM7686_2134      CDS       T02792                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pami  Paracoccus aminophilus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    JCM7686_2134
Enzymes [BR:pami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     JCM7686_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2202300..2202875
Genome map
AA seq 191 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMATLLLTAAIDDRAGDAVIASRIGISAPAL
TFSRDTDLCELIRREGKDAACIFLDEAQFLTEEQVWQLARVADDLSQPVMCYGLRVDFQG
KLFPGSAALLALADDLREVRTICFCGKKATMVIRQDDQGQPIREGAQVQIGGNETYVSLC
RSHWREAMQAP
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttacttccattactcgacgatgaatgccggcaagagcacgctcctcttg
caggcttcctacaattaccgcgagcgcggcatggcgaccttgttgctgaccgccgcgatc
gacgaccgcgcgggcgatgctgtcatcgccagccgcatcggcatttccgccccggcgctc
acgttttcgcgcgacaccgatctctgcgagttgatccggcgtgagggcaaagacgccgcc
tgcatcttccttgatgaagcgcaatttcttaccgaggagcaggtctggcagcttgcccgc
gtcgcggacgatctgagccagcccgtcatgtgctacggtctgagggtggattttcagggc
aagctgtttccgggctcggcggcgcttcttgcgctcgccgatgatctgcgcgaggtgcgc
acgatctgcttttgcggcaagaaggcgaccatggtcatccgtcaggacgatcagggccag
cccatccgtgaaggcgcgcaggtccagatcggcggcaatgaaacctatgtctcgctctgc
cgttctcattggcgagaggccatgcaagcgccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system