KEGG   Paracoccus aminophilus: JCM7686_2483Help
Entry
JCM7686_2483      CDS       T02792                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pami  Paracoccus aminophilus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    JCM7686_2483
Enzymes [BR:pami01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     JCM7686_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2577606..2578892)
Genome map
AA seq 428 aa AA seqDB search
MSDPRGVIAALRDGQGLDASGAALIARGLAEGTLSDAQAGAFAMAVLLRGTGRAGRIALT
EAMRDSGRVLRWDLPGPVLDKHSTGGIGDTVSLILAPVLAAAGAFVPMISGRGLGHTGGT
LDKLEAIPGCRVDLDEAALRRITAEVGTAIVAASGDLAPADRRLYAIRDESGTVESLDLI
TASILSKKLAAGLDGLVLDVKCGSGAFSRDLDTARDLARALVETANGAGCKTMACITDMD
QPLAPAAGNALEIRAVLEAFRTGEGALCALALDLAGEGLTLAGIDPARASEAFASGRAAE
IFGRMIAAQGGPCDLIERPDTYLGPAPVVRAVEAGGAGFVAAVDGTALGRAVVALGGGRV
RASDRIDPRVGLSQLLRKGDQVSTGAPLALVHARSEAEAEAAAAQVRAAYVIGEAPAQGP
LILERILA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccgcgcggggtcattgccgcgctgcgtgacgggcaggggcttgacgcctcc
ggcgcggctctgatcgcgcgcgggctcgcggagggcacgctgagcgatgcgcaggccggg
gcttttgccatggcggttctgctgcgcggcaccgggcgcgccgggcggattgccttgacc
gaggcgatgcgcgattcgggacgcgtcctgcgctgggatctgccggggccggtgctcgac
aagcattcgaccggcgggatcggcgatacggtcagcctgatccttgcgccggtgttggca
gctgcgggggcctttgtgccgatgatctcggggcgcgggctgggccataccggcggcacg
ctcgacaagctcgaggccattcccggctgccgggtcgatcttgacgaggctgcgctgcgc
cgcatcaccgccgaggtcggcacggcgattgtcgcggcgagcggcgatctcgccccggcc
gaccgcaggctttacgcgatccgcgatgaaagcggcacggtcgagagccttgatctcatc
actgcctcgatcctgtcaaagaagctcgcggcggggctcgacgggctggtcttggatgtg
aaatgcggctctggcgcgttttcgcgggatctcgacacggcgcgggatctggcgcgggcc
ttggtcgagactgcaaatggcgcgggctgcaagaccatggcctgcatcaccgatatggat
cagccgctcgcgcctgcggccggcaatgcgctggaaatccgcgcggtgctcgaggcgttt
cgcaccggcgaaggggcgctttgtgccttggcgctggatctggcgggggagggcctgacg
cttgcggggatcgaccccgcgcgggccagcgaggctttcgcctcgggtcgcgctgcggaa
atctttggccgcatgatcgcggcgcagggcgggccatgcgatctgatcgagcgccctgac
acctaccttggccccgcgccggtggtgcgcgcggtcgaggccggtggggcgggctttgtc
gcggcggtcgatggcacggcgcttggccgcgcggtcgtggcgcttggcggcggtcgggtc
cgggcgagcgaccgcattgatccacgcgtcggcctgtcgcagcttctgcgcaagggcgat
caggtgagcacgggcgcgccgctggcgctggtccatgcccggagtgaggccgaggcagag
gccgccgccgcccaggtccgcgccgcatatgtgatcggcgaggcacccgcgcaggggccg
ctgatcctcgaaaggatcctcgcatga

DBGET integrated database retrieval system