KEGG   Paracoccus aminophilus: JCM7686_2582Help
Entry
JCM7686_2582      CDS       T02792                                 

Definition
2-oxoglutarate dehydrogenase, E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pami  Paracoccus aminophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    JCM7686_2582
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JCM7686_2582
  Amino acid metabolism
   00310 Lysine degradation
    JCM7686_2582
   00380 Tryptophan metabolism
    JCM7686_2582
Enzymes [BR:pami01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     JCM7686_2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2678367..2681339
Genome map
AA seq 990 aa AA seqDB search
MNDQSFSGNAAFHDSSFLQGHNAAYVEQLYGQWAKDAASVDAAWDAFFRSLGDDLGAVER
EAKGASWSRPDWPPQPSDETTAALTGEWPMSSKSEADAALKKIAGKAADKGVTLTDEQMR
RAVLDSVRALMLIRSFRIRGHLFADLDPLGQREVPQTGELDPATYGFGPNDLDRPIFIDN
VLGLQIATMRQIVELMKRTYCGTFALQYMHISDPEQAAWLKERIEGYGKEIAFTREGRRA
ILNKLVEAEGYEKFLHVKYMGTKRFGLDGGEALIPAMEQIVKRGGALGVKDVVVGMPHRG
RLSVLANVMGKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDRTFDGNLVHLSLTAN
PSHLEAVNPVVLGKVRAKQDQLNDTEYRTAVLPILLHGDAAFAGQGVVAECLQLSGIKGH
RTGGTIHIIVNNQIGFTTAPSFSRTSPYPTDIALMVEAPIFHVNGDDPEAVVHAARVATE
FRQLFHKDVVLDIFCYRRFGHNEGDEPMFTNPAMYKNIKGHKTTLQLYTERLVQDGLIPE
GEIEDMKAAFQAKLNEEFEAGKTYKPNKADWLDGKWSGLSIEPEEYARGQTAISPEMMEE
VGKALVSQPGDIDLHKTVGRLLEAKAKMFETGQGFDWATGEALAFGSLVAEGHPVRLAGQ
DSTRGTFSQRHSALIDQTTEERYYPLNNIRKGQARYEVIDSMLSEYAVLGFEYGYSLSEP
NTLTLWEAQFGDFANGAQIMFDQFISSGEKKWLRMSGLVCLLPHGYEGQGPEHSSARLER
YLQGCAEDNWIVANCSTPANYFHILRRQLKRNFRKPLILMTPKSLLRHPLAVSSVDEFTT
GSSFHRVLQDDAERGKTDFKLVSDDKIRRVVICSGKVYYDLLQARNAAGAEDVYILRLEQ
FYPFPAQSMVRELERFKGAEIVWCQEEPKNQGGWTFVEPNIEWVLGRIGATHSRPRYVGR
AAAASPATGLGSRHKAEQEALVGEAITLGS
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcaatctttcagcggcaacgctgccttccatgattcctccttcctgcaaggt
cacaacgcggcctatgtcgagcagctttacggccaatgggccaaggatgccgcttcggtc
gatgccgcctgggatgcgttcttccgcagcctcggcgacgatctgggcgccgtcgagcgc
gaggccaaaggcgccagctggtcgcgcccagattggccgccgcagccctcggatgaaacg
acggccgcgctgaccggcgaatggccgatgtcctcgaaatccgaggcggatgccgcgctg
aaaaagatcgcgggcaaggccgccgacaaaggggtgacgctcaccgatgagcagatgcgc
cgcgccgtgctcgattccgtgcgcgcgctgatgctgatccgctcgttccggatccgcggc
catctctttgccgatctcgacccgcttgggcagcgcgaagtgccgcagaccggcgagctt
gatcccgcgacctatggtttcgggccgaatgaccttgatcgtccgatcttcatcgacaac
gtgctgggcctgcagatcgcgaccatgcgccagatcgtcgagctgatgaagcgcacctat
tgcggcacctttgcgctgcaatacatgcatatctcggaccccgagcaggccgcctggctg
aaagagcgcatcgagggttatggcaaggaaatcgccttcacccgcgaaggccgccgcgcc
attctgaacaagctggtcgaggccgaaggctacgagaagttcctccacgtcaaatatatg
ggcacgaaacgcttcggccttgatggcggcgaggcgctgatcccggcgatggagcaaatc
gtgaagcgcggcggtgcgcttggcgtcaaggatgtcgtggtcggcatgccccaccgtggc
cgcctgtcggtgctcgccaacgtcatgggcaagccctaccgcgcgatcttcaacgaattc
caaggcggcagcttcaagccggaagatgtcgacggttcgggcgatgtgaaatatcacctc
ggcgcctcgtcggaccgcaccttcgacggcaatctcgtccacctgtcgctgaccgcaaac
ccctcgcacctcgaggcggtgaacccggtcgttctgggcaaggtccgcgccaagcaggat
cagctcaatgacaccgaataccgcaccgcggtcctgccgatcctgctgcatggcgatgcg
gcctttgccggtcagggcgtcgtcgcggaatgccttcagctttctggcatcaagggccac
cgcaccggcggcacgatccatatcatcgtgaacaaccagatcggtttcaccaccgcaccg
agcttctcgcgcacctcgccctatccgacggatatcgcgctgatggtcgaagcgccgatc
ttccacgtcaatggcgatgatccggaagccgtggtccatgcggcccgcgtcgcgaccgag
ttccgccaactcttccacaaagacgtggttctggacatcttctgctaccgccgcttcggt
cacaacgaaggcgacgagccgatgttcaccaacccggcgatgtataaaaacatcaagggc
cacaagaccacgcttcagctttacaccgagcgtctggttcaggacggcctgatcccggaa
ggcgagatcgaggatatgaaggcggccttccaggccaagctcaacgaggaattcgaggcc
ggcaagacctataagccgaacaaggccgactggctggacggcaaatggtcgggcctctcg
atcgagcccgaggaatatgcgcgcggccagaccgcgatctcgcccgagatgatggaagag
gtcggcaaggcgctggtctcgcagccgggcgatatcgacctgcacaagaccgttggccgt
ctgctcgaagccaaggccaagatgtttgaaaccggtcaaggctttgactgggcgacgggc
gaggctctggcctttggctcgctggtggcagagggccatccggtccgcctcgccggtcag
gattcgacccgcggcaccttctcgcagcgccattccgcgctgatcgaccagaccacggaa
gagcgttactatccgctcaacaacatccgcaagggtcaggcccgttacgaggtcatcgac
tcgatgctgtcggaatatgcggttctgggctttgaatatggctattcgctgtccgagccg
aatacgctgacgctctgggaagcccagttcggcgacttcgccaatggcgcgcagatcatg
ttcgaccagttcatctcctcgggcgagaagaaatggctgcgcatgtcggggctcgtctgc
ctgctaccgcatggctatgaaggtcagggccccgagcacagctcggctcgtctcgagcgc
tacctgcaaggctgcgccgaggacaactggatcgtcgcgaactgctcgaccccggccaac
tatttccacattctgcgccgtcagctgaagcggaacttccgcaagccgctgatcctgatg
acgccgaaatcgttgctgcgccacccgcttgcggtgtcgtcggtcgatgaattcaccacc
gggtcgagcttccaccgcgtgctgcaagacgatgccgaacgcggcaagaccgatttcaaa
ctggtctcggacgacaagatccgccgcgtcgtgatctgctcgggcaaggtctattatgac
ctgctgcaagcgcgcaatgccgccggggccgaggatgtctatatcctgcgtctcgagcag
ttctatccctttccggcccaatcgatggtgcgcgagctggaacgcttcaagggtgccgag
atcgtctggtgtcaggaagagcccaagaaccagggcggctggaccttcgtcgagccgaat
atcgaatgggttctgggtcgcatcggcgcgacgcacagccggccgcgctatgtcggtcgc
gccgcagccgcttcgcccgcgaccgggcttgggtcgcgccacaaggccgagcaagaggcg
ctggtgggtgaagccatcaccctcgggtcctga

DBGET integrated database retrieval system