KEGG   Paracoccus aminophilus: JCM7686_3043Help
Entry
JCM7686_3043      CDS       T02792                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pami  Paracoccus aminophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JCM7686_3043
Enzymes [BR:pami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     JCM7686_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3148130..3149005
Genome map
AA seq 291 aa AA seqDB search
MTIYNLGSINIDHIYRLDHLPRPGETLGALDYRLGLGGKGANQSVAAARAGSKVVHLGAM
SDADNWVIEVLEGAGVATSGIARMAQTPTGHAIIMVEDGGENSIVLHGGANRALDPEQLA
ANLSEIGAGDILLMQNETSLQVMAATQAHATGARVVYSAAPFSIDALRAVLPYISVIALN
ELEAQELFAALGSDLPVDGLLITRGAEGAEYRDLRSGTTHEQAAFKVKAADTTGAGDCFA
GWFAAGLDRGEDIPTALRHASAAAALQVTRQGAGNAMPERAEVMQFLGAQG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctataatctcggctcgatcaacatcgatcacatctaccgtctcgaccacctg
ccccgcccgggcgagaccctcggcgcgctggattaccggctgggccttggcggcaagggc
gcgaaccaatcggttgccgccgcgcgtgcgggcagcaaggttgtccatctcggcgcgatg
tcggatgcggacaactgggtgatcgaggtgctggaaggcgcgggcgtcgcgacctcgggg
atcgcacgcatggcccaaacgccgaccggtcacgcgatcatcatggtcgaggatggcggt
gagaattcgatcgtgctgcatggcggcgccaatcgcgcgctcgaccccgagcagcttgcc
gcgaatctctctgagatcggcgcgggcgacatcctgttgatgcagaatgagacctcgctg
caggtcatggccgcgacgcaggcccatgcgaccggcgcgcgcgtggtctattccgccgcc
cccttctcgatcgacgccttgcgcgcggtcctgccctatatttcggtgatcgcgctcaac
gagcttgaggcgcaggagctctttgccgcactcggcagcgatctgccggtcgatggcctc
ttgatcacccgcggggccgagggcgccgaataccgcgatctgcgcagcggcaccacgcac
gagcaggccgcgttcaaggtcaaggccgccgacaccaccggcgcgggcgattgcttcgcg
ggttggtttgccgccgggcttgaccggggcgaggacatcccgacggcactgcgccatgct
tccgctgcggcggccttgcaggtaacgcggcaaggcgccggcaatgccatgcccgaacgc
gccgaggtcatgcagtttctgggcgcacagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system