KEGG   Paracoccus aminophilus: JCM7686_3364Help
Entry
JCM7686_3364      CDS       T02792                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pami  Paracoccus aminophilus
Brite
Enzymes [BR:pami01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     JCM7686_3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3490982..3491854)
Genome map
AA seq 290 aa AA seqDB search
MAKTGDPRVTLDDPHSFFMPGTNGRGVLLVHGMTGAPAEMRLVARLLNKRGYSVLAPLLA
GHGADEAEFRKYRWQDWQDSVEAAAEKLRAEVDETHAAGICVGGKLALLAAHRNPGTLRS
VALYSPCFSYDGWAVPFYYPLLSRHIGWLAHVPFLQRLSFSETPAMGIKDERLRRLMAGM
SADGVLDDFPGSGVVEMYRLGKLVRRELPQITTPTLILHAREDDLSNPRQAEYIDRHIGG
PHALHWIEDSYHMIHVDRQHRHVADLTARFIEAHSRSGVAATPAFETHDV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacaggtgacccgcgcgtgacgcttgacgatcctcattccttcttcatgccc
ggcaccaatggccggggggtactgctggttcatggcatgaccggcgccccggccgagatg
cgtctggtcgcgcggctgttgaacaagcgcggctatagcgtgcttgcgcctttgctggcc
gggcatggcgcggatgaggccgagtttcgcaaatatcgctggcaggattggcaggacagc
gtcgaagccgcagctgaaaagctgcgcgccgaggttgatgagacccatgccgccgggatc
tgtgttggcggcaagctggcgcttctggcggcgcatcgcaatcccggcacgctgcgctca
gtcgcgctttattcgccctgtttcagctatgacggctgggcggtgcctttctattatccg
ctgctctcgcgccatatcggttggctcgcgcatgtgccgtttctccagcgtctgagcttt
tccgaaaccccggcgatggggatcaaggacgaaaggctgcgccgtttgatggcgggcatg
tcggcggatggcgtgctcgatgatttccccggctcgggcgtggtcgagatgtatcggctg
ggcaagctcgtccggcgcgagctgccgcagatcaccacgccgacgctgatcctgcacgct
cgcgaagacgatctgagcaacccgcggcaggccgaatatatcgaccgccacatcggcggc
ccgcacgcgctgcattggatcgaggacagctatcacatgatccatgtcgatcgccaacac
cgccatgtcgccgatctgaccgcccgctttatcgaggcccattcccgctcgggcgtggcc
gccaccccggcattcgagacccatgatgtttga

DBGET integrated database retrieval system