KEGG   Paracoccus aminophilus: JCM7686_pAMI4p046Help
Entry
JCM7686_pAMI4p046 CDS       T02792                                 

Definition
kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
pami  Paracoccus aminophilus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    JCM7686_pAMI4p046
Enzymes [BR:pami01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     JCM7686_pAMI4p046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAMI4:53581..54828
Genome map
AA seq 415 aa AA seqDB search
MSDALSLDHLRGLDAGDPLKGFRADFVLPEGVIYLDGNSLGPAPKAALNALQHAGSAEWA
QDLIRSWNAAGWFQLPLELGDRVGRLIGAAPGQVAVCDSTSINIFKALSAAAGLRPDRKT
VLAEAGSFPTDVYIAEGFVASQPGYRLRLEGQDGASILDMLGPDVGVVLLNHVNYRSGRL
ADLVAVTRAIHEAGALVIWDLCHSAGALPIGLDAAEVDFAVGCSYKYLNGGPGAPAFIYV
AERHQAAARQPLSGWWGHARPFAFETHYEGAPAIARFLCGTQPILSLRALKGALEVWDRV
DLDALRAKSLQLTDLFIALVETRCADHGLALETPRDPAVRGSQVSFSHPHAYEIVQALIE
RQVIGDFRAPDVLRFGFTPLYLSHEDVWIAVETLRDILETGLWREPRFAARHAVT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcgctttcccttgaccatctccgcgggctggatgcaggcgacccgctcaag
ggatttcgcgcggatttcgtgctgcccgagggggtgatctatcttgacggcaattcgctt
gggcctgccccgaaagccgcgttgaacgcgcttcagcatgccgggagtgcggaatgggcg
caggatctgatccggagctggaatgcggcgggctggtttcagctgccgctggagcttggc
gaccgggtcgggcggttgattggcgcggcacccgggcaggttgcggtttgcgacagcaca
tccatcaatatcttcaaggccttgagcgccgccgccgggctgcgccccgatcgcaagacc
gtgctggccgaggcgggcagtttcccgaccgatgtctatatcgccgagggctttgtcgcg
agccagcccggctatcgcctgcgccttgagggccaggacggcgcgagcattcttgacatg
ctcggtcccgatgtcggggtggtgctgctcaatcacgtcaattaccgctcggggcggctg
gcggatctggtcgcggtgacccgcgccattcacgaagcgggcgcgctcgtcatctgggat
ctgtgccatagcgcgggcgcgctgccgatcgggcttgatgcggccgaggtcgatttcgcg
gtcgggtgcagctacaaatatctcaatggcgggcccggggcgcccgccttcatctatgtc
gccgaacgccatcaggcggcggcgcgccagccgctttcgggctggtggggacatgcccgg
cccttcgccttcgagacccattacgagggcgcgcctgcgattgcacgttttctctgcggc
acccagccgatcctgtccctgcgtgcgctgaaaggcgcgctcgaggtctgggaccgcgtc
gatctggatgctttgcgcgcgaaaagcctgcaattgaccgatctcttcatcgcgctggtc
gagacgcgttgcgcggaccatgggcttgcgcttgaaaccccgcgcgatccggctgtgcgc
ggctctcaggtcagcttttcccatccccacgcctatgagatcgtccaagccctgatcgag
cgtcaggtcatcggcgatttccgcgcccccgatgtgctgcgctttggcttcacgccgctc
tatctcagccatgaggatgtctggatcgcggtcgaaacgctgcgtgacattctggagacc
gggctttggcgcgagccgcgctttgccgcgcgccatgcggtgacctga

DBGET integrated database retrieval system