KEGG   Paracoccus aminophilus: JCM7686_pAMI4p107Help
Entry
JCM7686_pAMI4p107 CDS       T02792                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pami  Paracoccus aminophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pami00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JCM7686_pAMI4p107
Enzymes [BR:pami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     JCM7686_pAMI4p107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAMI4:123244..124131
Genome map
AA seq 295 aa AA seqDB search
MAQVVVIGNIALDETLAVEAFPEPGASIAGSALSEGVGGKGANQAIAMARALAGVAPVRF
VAAIGGDLRGARLRAGIEGEVLEARLISRDLPTDFSVILRDKNRENTIVTTQDCARSITG
EEAVAVLAEYGPGDALVLQGNLRAETSLAVLEAAKARGIWRVLNPSPVEGCTAEMLAACD
LLVVNEGEAETFGGAAHLSVGKVLVRTLGPRGAEVWQEGALVLKVAGVAVEALDPTGAGD
CFLAALVAAMIRRGAILPEAEDLDLAAWAAGLCVSRLGTQSAFPTVAEFQAAFTA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagtcgtcgtaattggaaacatcgcgttggatgaaaccttggcggtcgaggcg
tttcccgaacccggtgcctcgattgccggatccgcgctctcggaaggcgtcggcggcaag
ggcgcgaaccaggcgattgccatggcgcgggcgctggcaggcgtggctccggtgcggttt
gtcgcagcgattggcggcgatctgcgcggcgcgaggctgcgcgcggggatcgagggcgag
gtgctcgaggcgcggttgatctcgcgcgatctgcccacggatttctcggtgattttgcgg
gacaaaaaccgcgagaacaccatcgtcacgacgcaggattgcgcgcgctcgatcaccggc
gaagaggcggttgcggtgctggccgaatatgggccgggcgatgccttggtcttgcagggc
aatctgcgcgcggaaacctcgcttgcggtccttgaggccgcgaaggcgcgcgggatttgg
cgggtgttgaacccgtcgccagtcgagggctgcaccgccgagatgctggccgcttgcgat
ctgctggtcgtgaatgagggcgaggccgagacctttggcggcgcggcgcatctgtcggtg
ggcaaggttctggtgcggaccttggggccgcgcggggccgaggtctggcaggagggtgcg
ctggtcttgaaggttgcgggtgtcgcggtcgaggcgcttgatccgactggcgcaggggat
tgcttccttgcggcgctggtcgcggcgatgatccggcgcggcgcgatcctgcccgaggcc
gaggatctcgaccttgccgcttgggcggcggggctatgtgtctcgcgactgggcacgcaa
agcgcctttccgaccgtggctgaattccaagccgctttcacggcgtaa

DBGET integrated database retrieval system