KEGG   Podospora anserina: PODANS72p206Help
Entry
PODANS72p206      CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pan  Podospora anserina
Pathway
pan00630  Glyoxylate and dicarboxylate metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01200  Carbon metabolism
Module
pan_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PODANS72p206
Enzymes [BR:pan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PODANS72p206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 11176249
NCBI-ProteinID: XP_003437420
UniProt: B2ANA6
AA seq 608 aa AA seqDB search
MLRTILPSVPRRTLTARLTSALSSGSARAHAVRSLSTTAVTRMSSLPPANPPLTTTSAFE
AYQLLPEAQKAGAAEDALFEAQVKEVEAWWASSRFEGIKRDWTAADVVSKRGSLQQNYPS
SVMARKLWNLVREREAAGKPIHTLGAIDPIQMTQQAPHQEVLYISGWACSSLLTTTNEVS
PDFGDYPYNTVPNQVQRLFKAQSMHDRKHWFLRSKMSPEERAKTPYTDYLRPIIADGDTG
HGGLTAVMKLAKLFAENGAAAVHFEDQMHGGKKCGHLAGKVLVPTSEHINRLKAARFQWD
VMGTENLVIARTDSESGKLISSSIDVRDHEFILGVADPSVGSLAETLASMEAKGASGSEI
DAFEAQWVKSTKLVTFDDAAVAHFEKHGVPQEKIAGYQSAVKADRDMGISERRKLASSIT
PDAPVYWDWDVPRTREGFYHFRNGMNAATKRALAFGPYADLLWVETGDPNVQVAKDLGQA
VRSVYPGKGLVYNLSPSFNWMAHGFTPETLRSFIWDIAKEGFVLQLVSLAGLHSTATISN
ELAKKFKEDGMAAYVELVQRREKELGVDVLTHQKWSGASYVDAVLGHIQSGSSGSKSMGE
GNTEGQFE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaccattctccccagcgtcccccggcggaccctgactgcacggctaacctcc
gccttgtcttccggatcagctagggcgcacgccgttcgctccctatctacaactgcggtc
accagaatgtcttctctcccaccagcaaacccaccactgaccacgacgtcagcttttgag
gcctaccagctcttgcccgaggcgcaaaaggccggagcggccgaagatgccttgttcgaa
gctcaagtcaaggaggttgaagcctggtgggcttcttcccgttttgagggcatcaagcgc
gactggacagccgccgatgtcgtgagcaagcgcggctccctccagcaaaactaccccagc
tccgtcatggcgcgcaagctatggaacctcgtccgtgagcgcgaagctgctggcaaaccc
atccacacactgggcgccatcgaccctatccagatgacacaacaagcgccgcatcaggag
gtcctctacatctctggctgggcctgctcctcgctcttgacgaccaccaacgaggtttcc
cctgactttggcgactacccttacaacacggttcccaaccaggtccagcgcctgttcaag
gcgcaaagcatgcacgaccgcaagcactggttcctgcgctccaagatgagccccgaggag
cgcgcaaagaccccttacaccgactacctccgccccatcattgccgatggcgataccggt
cacggtggtttgaccgccgtcatgaagctggccaagctatttgctgagaacggcgcggcg
gcggtgcactttgaggaccagatgcacggcggtaagaagtgcgggcatttggctggcaag
gttctcgtcccaacgagcgagcacatcaaccgcctcaaggctgcccggttccagtgggat
gtcatgggaactgaaaacttggtgatcgcccgtaccgactcggagagcggcaagcttatt
tcgtcatctattgacgtccgtgatcacgagttcatcctcggtgttgcggacccctctgtt
gggtctcttgccgaaacgctggcttcgatggaagcaaagggtgcctctggttcagagatt
gacgcctttgaggcccagtgggtcaagtccaccaagctggtcacctttgacgacgctgcc
gttgcccactttgagaagcatggtgtgccccaggagaaaattgcagggtaccagtctgcc
gtcaaggctgacagggacatgggcatttctgagcgccgcaagcttgcctcgtctattacc
cctgatgcccctgtgtactgggactgggatgtcccccgcacccgtgagggcttctaccac
ttccgcaacggcatgaacgctgctaccaagcgtgcgttggcttttggtccctatgccgac
cttctctgggttgagactggtgacccgaatgtgcaggtggctaaggatcttggtcaggct
gtcaggtcggtctaccctggcaaggggctggtgtataacctcagcccctcgttcaactgg
atggcgcatgggtttaccccagagacgctcagaagcttcatctgggatattgccaaggag
gggtttgtccttcagcttgtcagcttggctggtctgcacagcaccgcgacaatcagcaat
gagctggccaagaagttcaaggaggatggcatggctgcttatgtggagcttgttcagaga
agggagaaggagttgggtgttgatgttttgacacaccaaaaatggagcggtgctagctac
gttgatgctgtgttgggccatattcagagtggcagctcagggagtaagagtatgggtgag
gggaatacggaggggcagtttgagtag

DBGET integrated database retrieval system