KEGG   Podospora anserina: PODANSg068Help
Entry
PODANSg068        CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pan  Podospora anserina
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PODANSg068
Enzymes [BR:pan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     PODANSg068
Glycosyltransferases [BR:pan01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PODANSg068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 961 aa AA seqDB search
MARSAAAKVASGRVSPPLPPNPAPTQPIPGTISTSSKNKNKGASKRPNDYTSEGVADNDV
FLLPGSDYQLLLGITFLAAAVRLFRIYQPTSVVFDEVHFGGFASKYIKGKFFMDVHPPLA
KLMITLFGYLAGFDGNFDFKEIGKDYLEPGVPYVAMRLFPAICGILLAPTMFLTLKAAGC
RTFIAAMGACLIIFENGLLTQARLILLDSPLMIATAFTALAFTSFTNQQELGPSRAFSPS
WWFWLVMTGLGLGMTVSIKWVGLFTIAWVGGLTLVQLWVLWGDHKNVTISTFSKHFLARA
FCLIAIPVAFYMAMFGIHFLCLVNPGEGDGFMSSEFQSTLNSKGMQDVPADVLMGSKVSI
RHVNTQGGYLHSHPLMYPTGSKQQQITLYPHKDDNNLWFLENQTQPLGADGLPINGTNAW
NNLEETPYIKNGAIIRVYHVPTHRRLHSHDVRPPVTEAEWQNEVSAYGYEGFDGDANDFF
RVEIVKKKSKAGVAQERLRTIDTKFRLVHVMTGCVLFSHKVKLPAWASEQQEVTCARGGT
LPNSLWYIESNEHAKLGPDAEKVNYANPGFLGKFWELQKVMWKTNAGLVESHAWDSRPDS
WPILRRGINFWGRNHRQIYLIGNPIVWWSATAAVVIYILFKGIAVLRWQRSFNDYADPVF
KRFDYEIGTSVLGWALHYFPFYLMQRQLFLHHYFPALYFSVIAFCQIFDFVVARISALGL
KKNPLIGKAGALLFLLISAAAFTLLSPLAYGNAWTKAECKRVKLFNTWDWDCNTFLDSYE
AYDQLANSPAAASPTSTSKPSVKVQAPAPAENPVAAGEQAKAPAVEQPKEKVSGAPAAGE
QRVVHTEERVEYRDQDGNLLDMEQVKALEGKVEFKTRYETRTRIIDAAGNEVFVGAQEGA
PVPVAPPHPDVEGVDRETPKNLVPDESIPAAEKSVEGEKEAEGKVPKPASESKEKTAKEE
L
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatcggcagccgcaaaagtggcatccggccgggtatcccctcccctgccaccg
aacccagcacctacccaacccatcccaggcaccatctcgacaagctcgaagaacaagaac
aagggagcttcgaagcgccccaacgactacacgtccgagggcgtggccgataacgatgtt
ttcctgctcccaggctccgattaccagctcttgcttggtatcaccttcctggccgctgcg
gtgcgcctgttccgcatctatcagcccaccagcgtcgtcttcgatgaggtccacttcggc
ggcttcgcttccaagtatatcaagggcaagttcttcatggacgtccaccctcctctggca
aaattgatgatcaccctcttcggttacctcgctggctttgatggaaacttcgacttcaag
gagattggcaaggactaccttgagcctggtgttccttatgtcgccatgcgcttgttccct
gctatctgcggtattcttctggctcctaccatgttcctcacgctcaaggctgccggttgc
cgcaccttcatcgccgccatgggtgcttgcttgatcatttttgagaacggtctgcttacc
caggcacgccttatcttgcttgactcccccctgatgattgctacggctttcaccgcgctt
gctttcacctccttcaccaaccagcaggagctcggcccctctagagctttctccccaagt
tggtggttctggcttgtcatgaccggtcttggtctcggcatgactgtcagcatcaagtgg
gtgggcctgttcacgattgcctgggttggcggcttgaccttggtccagctctgggttctg
tggggtgatcacaaaaacgtcactattagcaccttctccaagcacttcttggcccgtgct
ttctgcttgattgccattcccgtggccttttacatggccatgttcggtatccacttcctc
tgcctggtgaaccctggcgagggtgatggcttcatgagctccgagttccagtctaccctc
aactccaagggcatgcaggatgtccctgccgatgttcttatgggcagcaaggtctccatc
aggcacgtcaacacccagggcggctatcttcactcgcacccgctcatgtatcccaccgga
tccaagcagcagcagatcactctctaccctcacaaggacgacaacaacctttggttcctc
gagaaccagacccagcctcttggcgctgacggtctgcctatcaacggtaccaacgcgtgg
aacaaccttgaggagactccctacatcaagaacggtgccatcattcgtgtctaccatgtt
cccactcaccgccgccttcactctcacgatgttcgcccccctgttaccgaagctgagtgg
cagaacgaggtgtctgcttatggttatgagggattcgatggagacgccaatgactttttc
cgtgtcgaaattgtcaagaagaagtccaaagccggtgttgctcaggagcgccttcgcacc
attgacaccaagttcagacttgtccacgtcatgaccggctgcgtcctgttctcgcacaag
gtcaagctccccgcgtgggcctctgaacagcaagaggttacctgcgctcgtggtggcact
cttcctaacagtctctggtacattgagtccaacgagcacgccaagcttggtcccgacgcc
gagaaggtcaactatgccaatcctggcttcttgggcaagttctgggagctccagaaggtt
atgtggaagaccaacgctggacttgtcgaatcccacgcgtgggactcccgcccagactcc
tggcccatcctccgccgtggtatcaacttctggggcagaaaccaccgccagatctacctc
attggcaaccccattgtttggtggagcgccacagctgccgtcgttatctacatcttgttc
aagggaatcgctgttctccgctggcagcgtagcttcaatgattacgccgacccggttttc
aagcgctttgattacgagattggcacgtctgtgctcggctgggctcttcattacttcccg
ttctatctgatgcagcgccagctgttcctccaccactacttccccgctctctacttctcc
gtcattgctttctgccagatcttcgactttgttgttgcgcggatttcggctcttggcttg
aagaagaaccctcttatcggcaaggccggtgctctccttttcctgcttatctcggccgcc
gccttcaccttgctttctcctcttgcttacggcaacgcctggaccaaggccgagtgcaag
cgtgtcaagcttttcaacacctgggactgggattgcaataccttcctagatagctatgag
gcctatgaccagctcgccaactcacctgcggcggcttcgcccacttccacaagcaagccg
tcggtgaaggtccaggccccagcccctgctgagaacccggtggctgctggcgaacaggcc
aaggcccccgccgtggagcagccaaaggagaaggtttcgggagccccggcggctggtgaa
cagcgtgttgtccacaccgaggagcgtgttgagtacagagaccaggatggtaacttgctg
gacatggagcaagttaaggccctggagggcaaggtcgagttcaagacccggtacgagact
cgcactcgcatcattgatgctgccggcaacgaagttttcgtcggcgctcaggagggcgcg
ccggttcctgtggcgcctccacacccggatgttgagggtgtcgaccgtgagactcccaaa
aacttggttcctgacgaatccatcccggctgctgagaagagcgtcgagggcgagaaggag
gccgagggtaaggtccccaaacccgctagcgagagcaaggagaagaccgccaaggaggag
ttgtaa

DBGET integrated database retrieval system