KEGG   Podospora anserina: PODANSg09313Help
Entry
PODANSg09313      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 734 aa AA seqDB search
MAPKFPPSRCRCGQCRANKGSWKRIGSGRDVTDTMTSTTIGRLRVRLAITTILTCRCTKQ
TGHRCKQVFAVSLLSSFTKSPMFLLLRACKLSQGIASLSTLHLHSHYCQPALNFTIMPAS
RYPKRKPSANGAPSTNGTLNGTNGFIKPDPDQPPPEKKRKTVLAEPPSEPSLSSDPLREP
HPFHQDAEKHGIVLRKYYPHEMSTARARAYNNNELPRPIELLKAAQADTAEHRANTPVAG
AVVHWFKMDLRTTDNTALFCASQKAQAAGVPLIALYILSPQDFEAHLTAPVRVDFMLRTL
EILKKDLAALDIPLWVETVKKRKEIPSRIVELMGEWGASHLFANMEYEVDELRRDARMAR
LLAKRGLVMDVLHDTCIVPPGRLTSGSGGQYAVYTPWFRTWVRHVHENLDLLELVESPTK
NPESTRQKLAHLFECPIPSAPENKTLSKEDRERFRALWPAGEHEAMKRLSKFADQAIGKY
QQNRNIPSNPGTSSLSVHFASGTLSARTAVRTARGRNNTKKLDGGNEGIQTWIREVAWRD
FYKHVLVQWPYICMNKPFKPEYANIEWSYNMEHFDAWKEGRTGFPIVDAAMRQLRSMGWV
HNRCRMIVASFLCKDLLLDWRMGEKYFMEHLVDGDFASNNGGWGFSASVGVDPQPYFRIF
NPLLQSEKFDPDGEYIRKWVPELKEVKGKAIHDPYGRGAAALAIKAGYPKHIVDHKGARE
RTLAAYKKGIDSGL
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaattcccgccatcaaggtgtcgctgcggtcagtgccgcgctaacaaagga
agctggaaacggatcggatcggggcgcgatgtcacagacaccatgacgtccaccacgatc
gggcggctgagggtccggttggcgatcacaacaatcttgacgtgtcgctgcacaaaacaa
acgggccaccgctgtaagcaagtgtttgcagtgtcccttctttcctctttcacaaaaagt
cccatgtttctcctacttcgtgcttgtaaactctcgcaaggtattgcatctctgtccact
ctccacctacactcccactactgtcagccagctctcaacttcaccatcatgccggctagt
agatatcccaaacgaaagccctccgccaacggtgcgccaagcactaatggcacgttgaat
ggtaccaacgggttcatcaagcccgaccctgaccaaccgcctccagagaagaagcgcaag
accgtcctcgccgaacccccttccgaaccatctctgtcgtcagaccccttgcgagagccg
caccccttccaccaagatgccgaaaaacatggcatcgtcctccggaagtactaccctcac
gaaatgtccactgcgcgtgccagggcatacaacaacaatgagttgccccgacctatcgag
ctgctaaaggctgcacaggcagatacagctgaacacagagccaacacgccagttgcaggg
gcggtggtgcactggttcaagatggacttgagaacaacagacaacacggctctgttttgt
gccagtcaaaaggctcaggctgctggcgtgccactcattgcgctgtacatcctcagtccg
caagactttgaggcacacttgactgctcctgtgagggtggactttatgctgcggacactg
gaaatcttgaagaaggaccttgcggcgctggatatccctctctgggtcgagactgtgaag
aagagaaaggagataccaagcaggattgtggagctgatgggcgaatggggagctagtcac
ttatttgccaacatggagtacgaagtggacgagctgagaagggacgccaggatggcgaga
ctgctggcaaaaagggggcttgtcatggatgtgttgcatgatacctgtattgtgccgccg
ggaaggctgacaagtggaagcggtgggcaatatgcagtgtacacaccctggttcaggact
tgggttcgacacgttcacgagaatctagacttgttggagctggtcgaatccccaacgaag
aatcccgagtccacgagacaaaagcttgctcatctcttcgagtgtccaataccctcagca
ccagaaaacaagaccctgagcaaggaggatcgggaacggtttcgggctttatggccggct
ggggagcacgaggcaatgaaacggttgtccaagtttgcagaccaagccattgggaagtac
caacaaaaccgaaacatcccttccaaccccggcacctccagcctttctgttcactttgcc
agtggcacactcagcgcgaggacagctgttcggacagcccgtggtcgtaacaatacgaaa
aaactcgacggagggaacgaggggatccagacttggatcagggaggttgcgtggagggac
ttttacaagcatgtgctagtccaatggccgtatatctgcatgaacaagcccttcaaacca
gagtacgccaacattgagtggtcctacaacatggagcactttgacgcttggaaagaagga
cgtaccggatttcccatcgtcgacgccgccatgcgccagctccgttccatgggttgggtg
cacaaccgctgccggatgattgttgcttcctttctgtgcaaggacctgcttcttgactgg
aggatgggggagaagtactttatggagcatcttgtcgacggcgattttgcgagcaataac
ggaggatgggggttttcggcatcagtgggcgtggacccgcagccatacttccgcatcttc
aaccccctgctgcagagtgagaagtttgaccctgatggagagtatattcgcaagtgggtt
ccagagctgaaggaggtcaagggcaaggcaatccacgacccatatgggcgaggggctgcc
gccttggctatcaaggcagggtatccgaagcacattgttgaccataaaggtgcaagagaa
aggacattggctgcatacaagaagggaatagacagcggtctttga

DBGET integrated database retrieval system