KEGG   Podospora anserina: PODANSg09330Help
Entry
PODANSg09330      CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
Organism
pan  Podospora anserina
SSDB OrthologParalogGFIT
Motif
Pfam: Tannase
Motif
Other DBs
NCBI-GeneID: 6196875
NCBI-ProteinID: XP_001912284
UniProt: B2A9L6
Position
1
AA seq 600 aa AA seqDB search
MGILKYLAVAGLIASTSSSSLPDVCTTAFVESSLPAPDFFPGLELIAGSVTAQPVTNVTA
PPDSTHPGATGRDFCNVTFAYRHVGRPTDRVNLWLYLPSPAQFKKRFLATGGGGLSMTLG
ARGLATGLPYGAVSITTDAGFGGFDSDLSRVILYGNGAMNYDALIAYSYRAMHEMTVLGK
ELTRKFYNASNSTKIYSYFHGCSEGGREGMSQVQKYGTTFDGISVGSPAFRHPIFHYHGP
LSQRKINYFPSVCEFSRITADAIAFCDPLDGKTDGVVARTDLCFARFNASSSIGKPYNCS
AVPQLGQPPIAGTVSAKAAAVAAETWRGMYDSNNKLIHPFFAPSVEFGDSITILNPATNQ
LEPFPNPLSPAVVNLLIKEVYSPTLPLDEVSPDIVREWVNDSMAKYLSGIYTLWPDLTPF
KSNGGKMIFWHGEADAAIPAVSSTMYQDKVRKTMYPGLGVQQGYAEMSKWNKLFLVPGGG
HCDPGTVDPLGAFKPNSAAWPTEVLKSLMEWVEEGKDFERLEGIVQGGEKKGEKEGICGF
PLRPVWGGNNGSDGKGRGKGKGKGKGQQQSEDEEELQCVFDQQSFEFFTPKLDSFLVDAY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgggaattctaaaatatttggcagtggctggccttatagcatccacatccagttcgagc
cttcccgatgtctgcacgacggcttttgttgaatcgtctcttccggcaccagacttcttc
ccaggactcgaactaatcgccggttctgtcacagcccaacctgtcaccaacgtcactgct
ccaccagacagcacccatcctggcgccaccggtcgcgacttttgcaacgtcactttcgcc
taccgccatgtcggccgccctactgaccgagtcaatctctggctctaccttccaagtccc
gctcagttcaagaagcgtttcctggctacaggaggaggagggctgtccatgactttgggc
gcacgaggactcgcaactggtctcccctatggcgctgtctccatcacgaccgatgccggc
ttcggcggtttcgactccgacctcagccgtgttatcctctacggcaacggcgccatgaac
tacgatgccctcatcgcctactcctacagggcaatgcacgaaatgactgttctcggcaag
gagcttacccgcaagttctacaacgcctccaactcgaccaagatctactcctacttccac
ggctgctccgaaggtgggcgcgagggcatgtctcaagtccaaaaatacggcacgaccttt
gacggaatttccgttggttcccctgcgttccggcatcctatcttccactaccacggccct
ctttctcagcgcaagatcaactactttccctctgtttgcgagttctcacgcatcaccgcc
gatgctattgccttctgcgaccccctcgacggcaaaaccgacggcgtagtcgcacgtacc
gatctctgcttcgcccgcttcaatgcctcgtcctcgattggaaaaccctacaactgctcc
gctgttccccagcttggccagccacccatcgccggcactgtttccgccaaagccgccgcc
gtggcagccgagacctggcgcggcatgtacgactcgaacaacaagctcatccacccattc
tttgctccctcggtggagtttggtgactctatcacaatcctcaaccccgccacgaaccaa
ctcgagccgttccccaaccctctctccccggcggtggtcaatttgctgatcaaggaagtc
tactctcctaccttgccgctggatgaagtcagccctgatattgtccgcgagtgggtcaac
gattcaatggccaagtacctttctggcatctatactctctggccggatctcacgccgttc
aagtctaacggtggaaagatgatattctggcatggggaggctgatgctgcgattccggcg
gtttcatcaaccatgtatcaagacaaggtcaggaagacgatgtaccctggtttgggcgtg
cagcaaggttacgccgagatgtcgaaatggaacaagctgtttttggtgcctggaggtggg
cactgcgatcctgggacggtggatcctctgggggcgtttaagccgaacagcgcggcgtgg
ccaacagaggtgctgaagagtttgatggagtgggtggaggaggggaaggattttgagaga
ttggaggggattgtgcagggtggtgagaagaagggagagaaggaggggatttgcgggttt
cctctgagacctgtttggggcggcaacaatggaagtgatggcaagggcagggggaaagga
aaggggaagggtaaggggcaacagcaaagtgaggacgaagaggagctgcagtgtgtcttt
gaccagcagagctttgagttctttactcctaagctggacagttttttggtggatgcctat
tag

DBGET integrated database retrieval system