KEGG   Podospora anserina: PODANSg09330Help
Entry
PODANSg09330      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     PODANSg09330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 600 aa AA seqDB search
MGILKYLAVAGLIASTSSSSLPDVCTTAFVESSLPAPDFFPGLELIAGSVTAQPVTNVTA
PPDSTHPGATGRDFCNVTFAYRHVGRPTDRVNLWLYLPSPAQFKKRFLATGGGGLSMTLG
ARGLATGLPYGAVSITTDAGFGGFDSDLSRVILYGNGAMNYDALIAYSYRAMHEMTVLGK
ELTRKFYNASNSTKIYSYFHGCSEGGREGMSQVQKYGTTFDGISVGSPAFRHPIFHYHGP
LSQRKINYFPSVCEFSRITADAIAFCDPLDGKTDGVVARTDLCFARFNASSSIGKPYNCS
AVPQLGQPPIAGTVSAKAAAVAAETWRGMYDSNNKLIHPFFAPSVEFGDSITILNPATNQ
LEPFPNPLSPAVVNLLIKEVYSPTLPLDEVSPDIVREWVNDSMAKYLSGIYTLWPDLTPF
KSNGGKMIFWHGEADAAIPAVSSTMYQDKVRKTMYPGLGVQQGYAEMSKWNKLFLVPGGG
HCDPGTVDPLGAFKPNSAAWPTEVLKSLMEWVEEGKDFERLEGIVQGGEKKGEKEGICGF
PLRPVWGGNNGSDGKGRGKGKGKGKGQQQSEDEEELQCVFDQQSFEFFTPKLDSFLVDAY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgggaattctaaaatatttggcagtggctggccttatagcatccacatccagttcgagc
cttcccgatgtctgcacgacggcttttgttgaatcgtctcttccggcaccagacttcttc
ccaggactcgaactaatcgccggttctgtcacagcccaacctgtcaccaacgtcactgct
ccaccagacagcacccatcctggcgccaccggtcgcgacttttgcaacgtcactttcgcc
taccgccatgtcggccgccctactgaccgagtcaatctctggctctaccttccaagtccc
gctcagttcaagaagcgtttcctggctacaggaggaggagggctgtccatgactttgggc
gcacgaggactcgcaactggtctcccctatggcgctgtctccatcacgaccgatgccggc
ttcggcggtttcgactccgacctcagccgtgttatcctctacggcaacggcgccatgaac
tacgatgccctcatcgcctactcctacagggcaatgcacgaaatgactgttctcggcaag
gagcttacccgcaagttctacaacgcctccaactcgaccaagatctactcctacttccac
ggctgctccgaaggtgggcgcgagggcatgtctcaagtccaaaaatacggcacgaccttt
gacggaatttccgttggttcccctgcgttccggcatcctatcttccactaccacggccct
ctttctcagcgcaagatcaactactttccctctgtttgcgagttctcacgcatcaccgcc
gatgctattgccttctgcgaccccctcgacggcaaaaccgacggcgtagtcgcacgtacc
gatctctgcttcgcccgcttcaatgcctcgtcctcgattggaaaaccctacaactgctcc
gctgttccccagcttggccagccacccatcgccggcactgtttccgccaaagccgccgcc
gtggcagccgagacctggcgcggcatgtacgactcgaacaacaagctcatccacccattc
tttgctccctcggtggagtttggtgactctatcacaatcctcaaccccgccacgaaccaa
ctcgagccgttccccaaccctctctccccggcggtggtcaatttgctgatcaaggaagtc
tactctcctaccttgccgctggatgaagtcagccctgatattgtccgcgagtgggtcaac
gattcaatggccaagtacctttctggcatctatactctctggccggatctcacgccgttc
aagtctaacggtggaaagatgatattctggcatggggaggctgatgctgcgattccggcg
gtttcatcaaccatgtatcaagacaaggtcaggaagacgatgtaccctggtttgggcgtg
cagcaaggttacgccgagatgtcgaaatggaacaagctgtttttggtgcctggaggtggg
cactgcgatcctgggacggtggatcctctgggggcgtttaagccgaacagcgcggcgtgg
ccaacagaggtgctgaagagtttgatggagtgggtggaggaggggaaggattttgagaga
ttggaggggattgtgcagggtggtgagaagaagggagagaaggaggggatttgcgggttt
cctctgagacctgtttggggcggcaacaatggaagtgatggcaagggcagggggaaagga
aaggggaagggtaaggggcaacagcaaagtgaggacgaagaggagctgcagtgtgtcttt
gaccagcagagctttgagttctttactcctaagctggacagttttttggtggatgcctat
tag

DBGET integrated database retrieval system