KEGG   Podospora anserina: PODANSg09596Help
Entry
PODANSg09596      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pan  Podospora anserina
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pan00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 320 aa AA seqDB search
MVERPNKPSSLVATPGLPPQPTVNFSDDNSLVTATLPTGESITVLLYGATVISWKDSSST
EKLWLSSAAKLDGTKPVRGGIPLVFPVFGPPPAGHAQTSSLPQHGFARTSRWEFLGKSTS
ESSGDQQTGDLSVKLDFGLSSAADGLDPKGKAAWPFKFNLIYSVTLNRRDLTTSLVVTND
DERAFDCQVLMHTYLKVKDITNVTISGLDSSSYVDKVDAASTKTQSGEIRIEGETDRVYT
ADGPVIVSEGGKTLFTVTRDNLSNVVVWNPWVEKAKGMGDFEPKDGYKEMLCVEPGSVGG
WQTLEKGDAFEGAQTIALGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaacgccccaacaaaccctcctccctcgtcgcaacccccggcctccccccccaa
ccaacagtcaacttctccgacgacaactccctcgtcaccgccaccctccccaccggcgag
tccatcaccgtcctcctctacggcgccaccgtcatctcctggaaggactcctcctcgaca
gaaaagctctggctctcctcagccgccaagcttgacggcaccaagcccgtccgaggcggc
atccccctcgtcttccccgtcttcgggccccctcccgccggtcacgctcagacctcctcc
ctcccgcagcacggtttcgcccggacgtccaggtgggaattcctcggcaaatccaccagc
gagagctcgggcgatcagcaaacgggggacctgtccgtcaagcttgatttcggcctctcc
agcgcggcggacgggctggatccaaagggcaaggcggcctggccgttcaagttcaacctg
atctacagcgtgacgctgaacaggagggatctgacgacgagcttggtggtgacgaacgat
gatgagagggcgtttgattgccaggttttgatgcatacctatctcaaggttaaggacatc
acaaacgttactatttccggcctcgacagctcatcctacgtcgacaaggttgacgctgcc
tcgacaaagacacagtcgggggagattaggattgagggcgagacggacagggtgtacacc
gccgatgggccggtgattgtgtccgagggcggcaagactctctttaccgtcacgagggac
aacctctccaacgtggttgtctggaacccctgggtcgaaaaggccaagggcatgggtgat
ttcgagccaaaggatgggtacaaggagatgctctgtgttgagccagggtcggtaggcggc
tggcagacgctggagaagggggatgcgtttgagggagcgcagacgatcgctttgggggct
tga

DBGET integrated database retrieval system