KEGG   Podospora anserina: PODANSg09772Help
Entry
PODANSg09772      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pan  Podospora anserina
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PODANSg09772
  Lipid metabolism
   00600 Sphingolipid metabolism
    PODANSg09772
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PODANSg09772
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PODANSg09772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1073 aa AA seqDB search
MSQLPTRAAPFQLGNTGPQAANMAAKDLPDYCNEKVFRRNTLPPRSHNLDTARLSLNGQW
NFHYASNPSKSPDPTANTSHAASEGWTTIQVPGHWQLQGHGRPHYTNVQYPFPVCPPMVP
SENPTGTYSRSFFLPESFHDYQVRLRFDGVDSAYHVWVNKKEVGYAQGSRNPAEWDITKL
LDTEGPNEVIVKVYQWSDGSYIEDQDQWWLSGKQFLRTDLDAEYRDAILHATIDVFTTVD
LADLAVIVRTLPGEDTIAVVNQEVRSTGSIELSIPITNPKKWTAETPNLYLVEIQFNRLG
GVPITFSAVVRQKIGFRKVELKNGLISVNGQPIQFRGVNRHDHHPVFGRAVPVDFIRKDL
LLMKRHNINALRCSHYPSHPKLFDIADELGLWVIDEADLECHGFYDAVARPQDIPEEMDY
EERKKLAFGKAAEYTSNNPSWKAAYLDRMEQMIHRDKNHPSIIIWSLGNEAFYGQNHKAM
YTLATHLDPGRLVHYEGDAQAESADMYSFMYPTVDKLIELANTRGVKPDGTYQKPVILCE
YAHAMGNGPGGLEDYQHAFRTHPRLQGGFIWEWANHGLFKRDSDGKQYYAYGGDFGDTPN
DGTFVMDGLVNSAHQPTPGLVELKKVFQPVAVTVEGDELVISNLYDFSDLNHLSATYKAE
RLEISVVASGILNLPHIPAGETVRVAIPEDVHVWRKRKDSHQPHVYLTISFALRMPTTWA
ALGHEVAWFQHHLFNGHSMGPHAEDGGWLSFETTRTEAVITGHGFTCVFDKTSGYITSWT
HAGQKLLQPDPTTGAAIMPSFWRPPTDNDQALSVPYWKRFGVDTMTSQLRSVSVAGGDYY
CVGENGKKIFRKVIVTSTVFLAPPVLDWGYHATITYTIEMSGNLSIAVTLKATGYAPEHV
PRIGLNLCLPRQLDKVKWHGLGPGESYPDKRSAQRVGIWTAESVSELHTPYDVPQENGNR
MGTRWVTIVNPYSGGSGLFAEPGIYGYGNRDSGLDVPCNFAVSRYSTKTIQDAKHPCDLV
EENATLLRLDHKVAGVGTAACGPGVREDLLVKVDREKEVKFAFNLGPWSEVDA
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcttccaacaagggcggctcctttccagcttggaaacacgggcccccaagca
gcaaacatggcagcgaaagacctgcccgactattgcaatgagaaagtcttccgccgcaac
acgcttcctccacggtctcataaccttgacacggcaagactctcactcaacggccagtgg
aacttccattacgcttcgaatccttcgaaaagtcccgatccgaccgccaatacctcgcat
gctgcgtccgagggctggactaccattcaggttcctggtcactggcagcttcagggccat
ggccggcctcattacacgaacgttcagtacccgtttcccgtctgcccccccatggtgccc
tcggaaaatccaaccggcacatatagcaggtcattctttcttccggaaagttttcacgac
tatcaagtgcgtctgaggtttgatggcgttgacagtgcgtatcatgtctgggtgaacaaa
aaggaagtgggctatgcgcaagggtcccggaaccctgccgagtgggatataaccaagctg
ctggacacggagggtcccaacgaagtgatcgtcaaagtttaccagtggtctgacgggtca
tacattgaagatcaggatcagtggtggctctctggtaagcagttccttcggaccgaccta
gatgctgagtacagggacgctattctgcacgccacaatcgacgtttttacgacagttgac
ctagccgacttggcagtcattgttagaactctaccaggagaggacacgatcgctgtagtg
aatcaggaggttcgatcaaccggatcgatcgagctaagcatacccatcaccaatccgaag
aagtggaccgccgaaacccccaatctctacttggtcgagatacagttcaacaggctgggg
ggtgtccctatcaccttttcagctgtggtccgtcagaaaatcggatttcgcaaggttgag
cttaagaacgggttgatatccgttaatggccagccgatacagtttcgtggcgtgaataga
cacgaccatcaccccgttttcggaagagcagttccggtagacttcatacgaaaggatttg
cttctcatgaagaggcacaatatcaatgctttgcgatgcagccattaccccagccaccca
aaactgttcgacattgcggatgagcttggtttgtgggtgatcgatgaggcggatctcgaa
tgtcatggattctatgacgcggtcgctcgcccacaggatatccctgaggaaatggactat
gaagaacgtaaaaagctggcgtttggaaaggccgccgaatacacgagcaacaatccaagt
tggaaggccgcctacctggatcgcatggagcaaatgatacaccgggacaagaaccaccca
tctatcatcatttggtcacttggaaatgaggcattctatggtcagaatcacaaagcaatg
tacacccttgccacacacctggatcccgggcggctggtgcactatgagggtgatgcccag
gctgagtctgcagacatgtactcgttcatgtacccaactgtcgacaagctcatagagctg
gccaacacacgaggcgtcaaaccggacggtacctaccagaagcctgtgattttgtgcgag
tatgcccacgcaatgggaaacggcccgggcgggctcgaagattatcagcatgcgtttcga
actcaccctcgcctgcaaggcggttttatctgggagtgggctaatcacgggcttttcaag
cgggacagcgatggcaagcagtactacgcttacggcggtgactttggagatacacccaat
gacggcactttcgtgatggacggtctggtcaacagcgctcatcagccaacgccgggcctg
gtggaactcaaaaaagtgttccaacctgttgctgttactgttgaaggagatgagctggtc
atttcgaatctatatgacttttccgatctcaaccatttgtcagccacctacaaggccgaa
aggttagaaatcagtgtcgtggcctccgggattttgaacctcccgcatataccagccggt
gaaacggtgcgagtcgcgatccctgaggatgtacatgtctggcgcaagaggaaggatagc
caccagccccacgtatacctcacgatatcgtttgctttgaggatgcctactacgtgggca
gccctcggccacgaggttgcatggtttcagcatcacctcttcaacgggcactctatgggc
cctcacgccgaagacggaggctggctctcttttgaaaccactcggaccgaggctgttatc
accggccacggcttcacctgtgtgtttgacaaaacctccgggtacattacaagttggaca
catgcaggtcagaagcttctgcagcctgatccaacaactggcgcggccattatgccgtcg
ttttggcgtccgcctaccgacaatgatcaagccttatctgtgccatactggaagcgtttc
ggtgtcgacaccatgaccagtcagctccggtcggtcagtgtggctgggggagattattac
tgcgtgggagagaacggcaagaagatcttcaggaaggttatagttacgtctacagtgttc
ctggctcctccggttctcgactggggctaccatgcaacaattacctacaccatagaaatg
tcgggaaatctcagcatcgccgttactctgaaagccacaggttacgctcctgagcacgtg
ccccgcatcgggctcaacctgtgtctccccaggcaactggacaaggtcaaatggcacggc
ctcgggccgggcgagtcatatcccgacaaaagatcggcccagcgggtgggaatctggacg
gcagagtctgtttcagagctacacacaccctatgacgtcccacaagagaacggcaacagg
atgggcacgcggtgggttaccattgtgaacccttatagcggcggatcggggctgtttgcg
gagcccggtatatatggatacggcaacagagacagtggtctggacgtgccatgtaatttt
gctgtgtcgcggtactcgacaaagacgatccaggacgcaaagcatccgtgcgacttggtg
gaggagaatgccacgcttcttaggctagatcacaaggtcgccggggtaggcacggccgcc
tgcggtccgggggtgagggaagatttgttggtcaaggtggacagggaaaaggaggtcaag
tttgcgttcaacctcgggccatggagcgaagtggatgcgtga

DBGET integrated database retrieval system