KEGG   Podospora anserina: PODANSg09783Help
Entry
PODANSg09783      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg09783
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PODANSg09783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 520 aa AA seqDB search
MHHPTLCAVAVALLSALPGAQAGLYSKKSPVLQVDAKSYDRLIAKSNHTSIVEFYAPWCG
HCKNLQPAYEKAAKNLAGIAKVAAVDCDDDANKQFCGQMGVQGFPTLKIVRPKKGGGKPM
VQDYNGQRTASGIVEAVVQAMNNHVVKVEDKTLDKFLDDEKDAPKALLFTDKGTTSSLLK
SIAIDFLDVITVGQVRNTQAKAVEKFGITKYPTLILLPGGDAPAVTYDGELKKEALVTFL
SQAGAPNPDPAPAKPKAAKKEKKSEKKTEKKTEKKAEKKADSSESSSTAESEPEVPTQEA
PVIIEKALPIPTINSQEKLIKECLTEKSHTCVLAFVSNSESDLAKKALDSLAQLSFKYAQ
GKRNLFPFYEVPTSINGAAPLLKALDLTNEVEIIAINARRGWWRHFEGADFAHTTVESWI
DAIRMGEGSKKKLPEGIVAISVEQPTPATPEPEADPTAADTPDATEAATSEEPTPLTPEE
NATRVPPESSATEATDPEPECQTGAAEQCGARPAAEHDEL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccccacactctgtgccgtggcagttgccctgctgtctgcgcttccaggagct
caggctggtctctactccaagaagtctcctgtcttgcaggtggatgcgaagagctatgac
agactgattgcgaagagcaaccatacctctattgtcgaattctatgccccatggtgcggc
cactgcaagaaccttcagccagcctacgaaaaggctgccaagaacctggctgggatcgcc
aaggtagccgcggtggactgcgatgatgatgccaacaagcaattctgcggtcagatgggc
gtgcagggcttcccaacgctcaagattgtcaggccaaagaagggaggtggcaagccgatg
gtgcaagactacaatggccaaagaacagcaagcggtattgtcgaggctgtggtgcaagcc
atgaacaaccacgttgtcaaggttgaggacaagaccctggataagttcttggatgacgag
aaggacgccccaaaggctcttctctttactgacaaggggactacatcctccttgctcaag
agcattgccattgacttcctcgacgtgatcacagtcggacaggtgcggaatactcaggcc
aaggccgtggagaagttcggcatcaccaagtatcccacccttatccttctgccgggcgga
gatgccccggcggtaacctacgacggagagctcaagaaggaggctttggtcacattcctc
tcgcaagccggagcgcccaaccctgacccagcgcctgctaagcccaaggctgcaaagaag
gaaaagaaatctgagaagaagactgagaagaagaccgagaagaaggccgagaagaaggcc
gattcatccgagtcgtcatccacagccgaatccgagcctgaggttccaacacaagaagcc
cccgtcatcatcgagaaggccttgcccattcccaccatcaactcccaggagaagctgatc
aaagagtgcctgaccgaaaagtctcacacttgcgtccttgcctttgtctccaacagcgaa
agcgacttggccaagaaggcactcgacagcctggcccaactctccttcaaatacgcccaa
ggcaagcgcaacctcttccccttctacgaggtacccaccagcatcaacggcgccgcccct
ctcctcaaggccctcgatctcaccaacgaggtggagatcatcgccatcaacgcccgcagg
ggctggtggcgccactttgagggtgccgactttgcgcacaccacggtggagagctggatc
gacgccattcgtatgggcgagggttccaagaagaagcttcccgagggcattgtggccatc
tcggtggagcagcccacaccggctactccggagcccgaggcggacccgactgctgcggac
acccccgacgcgactgaggccgccaccagcgaggaacccactcctctgactcccgaagag
aacgccactcgagttccacccgagtcctccgcgaccgaggccacggatcccgaaccagag
tgccagactggtgctgccgagcagtgcggggccaggcctgccgcagagcatgacgagctt
tga

DBGET integrated database retrieval system