KEGG   Podospora anserina: PODANSg09832Help
Entry
PODANSg09832      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pan  Podospora anserina
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PODANSg09832
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PODANSg09832
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     PODANSg09832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 643 aa AA seqDB search
MSTTGNIAITGIPTTAGPDGSFPLRRELRDLQRNYPDHFNLLVLALKDFQALNESVQTSY
YQIAGIHGLPYKPWNNVGSNSDWQSTSGFGGYCTHSSILFLTWHRPYLALFEQALYNSIQ
KIANQFPQGPLRTKYVEAAKTFRMPYFDWASQPPSGSSAFPSAFTAPSLQVVDVDGKTKS
TANPIYRFVFHPVNPSPGDFPRQWSRFPTTVRYPNPRTGQSQDNRVAPILANELASLRTN
VSLLLLSYTNFDAFSFNRWDPNMTPGEFGSLEDVHNEIHDRTGGGGHMSSLDVSSFDPLF
WFHHTNVDRLWAIWQDLNPDNFLTPRPAPYSTFNSTEGESQTKDTPLTPFWDKSATKFWT
SEEIKDTTTTFGYAYPETQEWKYRTGSEYQTSIRQAVTTLYGTNVFANFAAANVQARATE
HTELIKSLSLAAPPPSAPITAEKPLLITQEMKASPIPEHLQHLAPNNKYPEWVVNIRAQK
HGLHGAFRVIVFLGPIDESDPDSWQTEFNTVGRVSVLGRSTQGPTTTKCAKCITDAADEL
MISGTVPLTSALLQDIVNENTGLHSLQPEEVVPYLKKELKWKVTMFETGAEKDCGEVPGL
RVSVTSTEVTIGEDGLPDYSGVYTVYPEITDGKPGGMRDGEHI
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacaggcaacattgcgattactgggattcctaccacggccggtccagatgga
tcgttcccccttcgccgagagctccgggacctccagcgcaactatcctgaccacttcaac
ctcctcgtccttgcgctgaaggacttccaagccctcaacgagtcagtccagacatcctac
taccagatcgctggtatccatggtctgccctacaagccttggaacaacgtcggcagcaac
agtgactggcagtcgacaagcgggttcggggggtactgcacccattcctcgattctcttc
ttaacatggcaccgtccgtaccttgctctcttcgagcaggctctgtacaactccatccag
aagattgccaaccagtttcctcaaggccccctccgaaccaagtatgtcgaggcggccaag
acattccgcatgccttacttcgactgggctagccagccaccttctgggtcttcagctttc
cccagtgcttttacggccccgagcctccaagtggttgatgtggatggcaagaccaagtcc
actgccaacccgatctaccgcttcgtgttccacccggtgaacccctcgccgggcgacttt
cctagacagtggagccggtttcccacaactgtccgctaccccaacccgagaactgggcag
tctcaggataaccgcgtggcacccatcctggccaacgagctggcttctcttcgcaccaac
gtcagccttcttctgctgtcttacaccaactttgacgccttcagcttcaacagatgggac
ccgaacatgacccctggcgagttcggcagtcttgaggacgtacataacgagatccacgat
cgaactggagggggcgggcacatgtcttctttggatgtgtcatcgtttgatcccctgttc
tggttccatcataccaacgtcgaccgtctctgggccatctggcaagacctcaaccccgac
aacttcttgaccccccgtccagccccttactcgacctttaactcgacggaaggcgagtcc
cagaccaaggacacccccctgacccccttctgggacaagtcagctaccaagttctggacc
tcagaggagatcaaggataccacgaccaccttcggctacgcctaccccgagactcaagag
tggaagtacaggaccggctccgagtaccaaacctccatccgacaggcagtcacaaccctc
tacggcaccaacgtctttgccaacttcgccgctgccaacgtccaggccagagccaccgag
cacacagagctgatcaagagcctgtccctcgccgctcctcccccttcggctcctatcaca
gcagagaaacccctcctcatcacccaagagatgaaggccagccccatccccgaacatctc
caacacctcgccccgaacaacaagtaccccgaatgggtggtcaacatccgcgcccagaaa
cacggcctccacggtgccttccgcgtcatcgtcttcctcggccccattgacgagtccgac
cctgactcttggcagacagagttcaacactgtcggccgtgtctctgtccttgggcgctcc
actcaaggaccgacaaccaccaagtgcgccaagtgcatcactgatgcggcagatgagctg
atgatctctgggacggtgcctttgacttcggccctgttgcaggatattgtcaatgagaat
actggcttgcatagcctgcagccagaggaagtggtgccgtatttgaagaaggagctcaag
tggaaggtgacgatgtttgagactggggcggagaaggattgtggggaggttccggggttg
agggtgagtgtcactagcactgaggttactattggggaggatgggctgccggattattcg
ggggtgtataccgtgtatccggagatcacggatggaaagccgggtggtatgagagacggt
gagcacatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system