KEGG   Podospora anserina: PODANSg0985Help
Entry
PODANSg0985       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 2499 aa AA seqDB search
MFGLHCRNYDENQRKRAARQIRDLMGAEQFQRFFDNVNQRTNLLIQGPDTYDRLGGIYIL
DALVDFDGIEPALKYTRFQNYIGSILRGRDINSMQPAAVVLGKLCKPGGSLISELVDSEV
QTALEWLQSDRIEERRYSAVLVLRELARNTPTLMYNYVGYVFEQIWIGLRDSRLLIRETA
SETVSACFKIIRERDQELKKDWMDKMLNEAIKGLKINTVEFIHASLLVLKELLEQGGMYM
QAHYQEACEIVFRHKDARDPAIRKTVVLLIPDLANYAPTEFSASYLHMFMVYLGGMLKKD
KDRNDAFLAIGNIANSVKSAITPYLDGVLIHIREGLSVQSRKRSSVDPVFDCISRLAVAV
GQTMSKYMEALLDPIFACELTPKLTQALVDMAFYIPPVKATIQERLLDMLSKVLCGEPFR
PLGAPHPNSLASIPHIPKDPKDPLAHQRTKDEVKLALNTLGSFDFQGHVLNEFVRDVAIK
YVEDDDPETREAAALTCCQLYVRDPIVNQTSYHALQVVADVIERLLTVGVSDPEPKIRQT
LLAALDERFDQHLAKAENIRTLFFALHDEQFAVREVAVSIIGRLARHNPAYVIPQLRKTI
IQMLTELEYTDVARSKEESSRLLSLLTRHAQELVKPYVNSITQVLLPKARDPIPSVAATV
LQALGELCTVGGEEMLNYKKDLMPIIIDALQDQSAPVKREAALHTLGQLASNTGYVIKPY
LEYPQLLEILQSIIRGEPQRGLLRQETIKVMGILGALDPYKYQVQRNCSFVPLRHAHFSA
LSSATPTMEDSDDSDDENDNVALFLGPYSPPEVVEKQKRKVTSKNKAKTPEQQVEDRAPR
TQKQTEATQLTDVSLMMGGLTPSQEDYYPTVVINALLQILKDQSLVQWHGNVVDAIMSIF
ITLGLKCVQFLDRVVPAFIAVIRASSQTRLDFYFNHLSRLVGIVRQHIRVYLPDIIEVLQ
EYWDTTYSLQTTIMSLIESIARSLEGEFKVYLASLLPMMLGLLEKDTTTKRQPTEKIFHA
FLVFGSSAEEYMHLIIPVLVRLFDNSAQPMFLRKSAIETIGKLSSMVNLNDYASKIIHPL
TRVLASHEPSLRVAALDTLCALMLQLGRDYLHFEHTVHKTISTYGLQHSNYDKAVEKLKK
GETLPPNLAPRFEDNAVELHASENSPPKKLDLNPMHLRQAWETKGKSTKDDWHEWFRKFS
TTLLSESPNHSLRACASLASTYQPLARELFNSAFVSCWSELYEQFQVGQELSCRDPPASL
LMLVQEELITNIENTIKSENVPPDLLGLLLNLAEFMEHDDKALPIDIRTLGREAARCHAY
AKALHYKELEFLQDHNSHAVEALIVINNQLQQSDAAIGILTKVKAYKDGITLRESWFEKL
ERWDEALNFYCQRERELPPDQPTPVDIVMGKMRCYHALGEWDSLASLAGKTWSNSAPEVQ
RMIAGLATTAAWGLGKWDSMDNYLQSMKRFSPDRAFFGAILALHRNQFREALGCIDQARE
GLDTELSALVSESYNRAYQVVVRVQMLAELEELIIYKQCDAEKQASLRATWETRLKGCQR
NVEVWQRMLRLRSLVLTPPENMHMWTKFANLCRKSGRMGLAEKSLRQLIGSDVPLDTVIP
HWHDRPMDPDAERLASPVLYAVLKYQWEVGLQPAMRNTDRTIAERTLYCLRKFTDETAHR
VESARHQIAASTQAGNGAIDGLHQASTFSEFDEAALLSPDVQRHWTEQTVLLAKCYLRQG
DWMIALNKDDWQYTRRKDILSCYYKATYYHRHWYKAWHAWALANFEVVQALGSRKDLDSG
VIIQYAVPAVHGFFESISLSSGSSLQDTLRLLTLWLTYGGNPDVASTVTEGFSRVSVDTW
LEVIPQLIARITQPNKKVQASIHALLSDVGRAHPQALVYPLTVAMKSRQSTRRSKTASLI
METIRQHSNKLVEQAETVSRELIRTAVLWHELWHEGLEEASRLYFGDHNIKGMFDALEPL
HDLLEKGPQTLREVSFTQTFGRDLGEAREWCRQYRETEDVNDLNQAWDLYYQVFRRISRQ
LPQMTTLELTYCSPDLLQARDLELAVPGTYRSGQEVVRIMSFDGTFTVISSKQRPRKLDI
VGSDGKTYTFLLKGHEDIRQDERVMQLFGLCNTLLANDSECYKRHLNIQRYPAIPLSQNS
GLLGWVPDSDTIHQLIRDYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNT
TGQDLYRVLWLKSKSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKII
HIDFGDCFEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCEHVMRVLRDNKESV
MAVLEAFIHDPLLTWRLTNPASPAGPHFNSEREQAIAGPQAARVRRPSILEAPMAPTEFL
AAQAGPEGLTGARSRARTNSSAAPLPSITNDGVHGPIEIAEVQNARAVEVLDRVSQKLTG
RDFKPNEELLVKDQVNKLIIEATKLENLCQHYIGWCSFW
NT seq 7500 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcttgcattgcagaaactatgatgaaaaccaaaggaaacgggccgcgcgccaa
atcagagacctgatgggtgccgaacagttccagcgcttcttcgataatgtcaatcagcgt
acgaatctattgatacaaggtcccgatacgtatgaccgtcttggtggaatttacatcctg
gatgcgttggtcgattttgacggcatagaaccagccttgaagtacacccgcttccagaac
tacattggcagcatcctgcgtggccgcgatatcaactctatgcagccggccgctgtcgtc
cttggaaaactatgcaagccaggcggttccttgatttccgaactggtcgattccgaagtt
caaacagcgcttgagtggctacagtctgaccgaatcgaggaacggcggtactcggcagtc
ttggtgcttcgcgagctggccagaaacacgcctacgttgatgtataactatgtgggctac
gtctttgaacagatttggattggccttcgtgactcccgtctcttgattcgcgagactgcc
agcgagaccgttagcgcctgtttcaaaatcattcgtgagcgagaccaggagctgaagaag
gactggatggacaagatgctcaacgaggcgatcaaggggctcaagatcaacacggttgag
tttatccatgcctcgcttcttgtgctcaaggagctgcttgaacagggtggcatgtacatg
caggctcactaccaagaggcctgtgagattgtcttccgccacaaagacgcgcgcgatccc
gccatccgcaagacggttgtgcttttgatcccggacctggccaactatgcaccgacagag
ttctcggcgagctatttgcacatgtttatggtgtatcttgggggcatgctgaagaaggac
aaggaccgcaacgacgcctttcttgccattggcaacatcgccaattcggtcaagagcgca
atcacaccctatttagacggcgttctcatccatattcgcgagggtctcagtgtacagtcc
cggaaacgaagctcggtcgatcctgtttttgactgcatcagtcgattggccgtcgccgtg
ggtcagacaatgagcaagtatatggaggcgcttcttgatcccatcttcgcctgcgagctc
acgccaaaactgacacaggcccttgtcgatatggcgttctacatccccccagtcaaagcc
accattcaagagcgcctgttggacatgctgagcaaagttctctgcggcgaacccttcaga
cctctgggtgcaccccatccaaactcgctcgcttccatacctcatattcccaaagaccca
aaggacccccttgctcaccagcggacaaaggatgaagtcaagttggccctcaacacgctc
ggcagctttgattttcaaggccatgtcttgaacgaattcgtccgcgacgtcgctatcaaa
tacgtcgaagatgatgacccagaaacacgtgaggctgctgccctcacctgctgccagctc
tatgtgcgtgacccaatcgtcaaccagacaagctatcatgccctccaagtggtcgccgat
gtcatcgagagactcctgactgtgggtgtttcggatcccgaacccaaaatacggcagacg
ttgctagcagcccttgacgagcgatttgaccagcatctcgccaaggctgagaatatacgc
accttgttcttcgcgctccacgatgaacagtttgccgtcagggaggtggccgtgtccatc
ataggccggttggctcgccacaatcccgcctatgttatcccccagctgcgaaaaaccatc
attcagatgttgacagagcttgaatacacagatgtggctcggagcaaggaggaaagctcg
agattactcagtcttctcacacggcacgctcaggagctggtcaaaccatacgtcaactcc
atcacccaagtgttgctgccaaaagctcgcgacccgatcccgtccgttgctgcgactgtc
ctccaagcactcggggaactgtgcaccgttggtggagaagagatgctaaactacaagaag
gatctcatgcccatcatcattgacgcattgcaggatcaaagcgcaccagttaaacgggag
gcagccctgcataccctcggtcagctggccagtaacacaggctatgtcatcaaaccctac
ctcgagtatccccaacttcttgagatcctgcagtccatcatccggggcgagcctcagcgc
gggcttttacgacaggaaaccatcaaggtgatgggcatcctgggagcactcgatccctac
aaatatcaggtacagcgcaactgttcttttgttccccttcgccacgcccatttcagcgca
ttgtcctctgctactccaaccatggaagactcggatgattcggacgatgagaacgacaac
gtcgccctctttctcggaccgtactcccctcctgaagtggttgaaaagcagaagcgcaaa
gtaacgtcgaaaaacaaggctaaaactccagaacagcaggtcgaagatcgcgcgccgcgc
acacagaagcaaaccgaagcaacccaactcactgatgtgtccctcatgatgggcggacta
accccttcacaggaggactactacccaaccgttgttattaatgcccttctccagatcctc
aaagaccagtcgttggtgcagtggcacggaaacgtggtggatgccatcatgagcatcttc
atcacgcttgggctcaagtgtgtccagttcctcgaccgtgtggtgcctgcctttatcgcc
gtgatccgcgcctcgagccaaacgcgactcgacttctatttcaaccaccttagtaggctt
gttggaattgtccgtcagcatatcagggtctacctcccggacatcatcgaggttctccag
gagtattgggacacgacatattcgctccagaccaccatcatgtcgttgatcgagtccatt
gcacgctccctagagggcgagttcaaggtctaccttgccagtctcctcccgatgatgctc
ggcttgctggaaaaggacaccaccaccaagcggcaaccgaccgaaaagatctttcatgct
ttcctagtgttcggctcaagcgccgaggagtatatgcacctcatcatccccgtgttggta
cgtctcttcgacaactcggcccaacccatgtttctgcgcaagtctgccattgaaacgatt
ggcaagctctcgagcatggtgaatctcaacgactatgcgtccaaaatcatccaccccctc
acccgggtccttgccagccacgaaccaagtctaagagtggctgccctcgacacgctatgt
gccctcatgttgcagctggggcgtgattatttgcactttgaacacaccgtccacaaaacc
atctcaacatacggcctccaacactccaactatgacaaggccgtcgaaaagctcaagaaa
ggggaaacattaccgcctaacctcgcgccgcgcttcgaggacaatgcagtcgagcttcat
gcctctgaaaacagcccgcccaagaagttggatctcaaccccatgcatttacggcaagcc
tgggaaaccaagggtaagtctactaaagacgactggcacgagtggttccgcaagtttagc
acgacgttactttctgagtccccgaatcactcactccgagcttgcgccagtttggcaagc
acttatcagccactggcaagggagctcttcaactctgccttcgtctcatgctggagcgag
ctgtacgaacaatttcaggtaggccaagaactgagttgccgcgatcccccggcaagttta
ctaatgctcgtgcaggaggaactgatcaccaacatcgaaaacacaatcaaatccgagaat
gtgcctcctgatcttctgggccttttgctgaaccttgccgagttcatggaacatgatgac
aaggccctaccaatcgacattcgaaccttgggacgtgaggcggcaagatgtcacgcctat
gccaaagcgctgcattacaaagaactcgagtttcttcaggaccacaacagtcacgcggtc
gaagccctgattgtgattaacaatcagttgcagcagtccgatgccgccattggtatcttg
actaaggtgaaggcgtacaaggacgggatcacgctgcgggaaagctggttcgagaagctg
gaacgctgggatgaggcgcttaacttttactgccaacgcgaacgcgagcttccgcctgac
cagcccacaccggtcgacattgtcatgggcaagatgcgttgctaccatgcgctgggtgag
tgggattcgctagcctcgctggctggcaagacatggtcaaactcggcaccagaggttcaa
cgcatgatcgcaggccttgccaccacggctgcctgggggctcgggaaatgggactctatg
gataactacctgcagtctatgaaacgattctcaccagatcgcgccttcttcggcgccatc
ttagccctccaccgcaatcagttccgagaagccctgggctgcatcgaccaagctcgagaa
ggtctcgatacagagctgagcgccctcgtgagcgaatcctacaacagggcataccaagtt
gttgtgcgcgttcagatgcttgcagagttggaagaattgatcatctacaagcagtgcgat
gctgaaaagcaagccagtttgcgggcaacatgggagactcgtctcaaggggtgccagcga
aacgttgaggtatggcagcgcatgctgcgactccggtcgctcgtgctcacgccaccagag
aacatgcacatgtggactaagttcgccaacttgtgccgcaagtctggacggatgggtttg
gcggagaagtcactgagacagcttatcgggtcggatgtgccgctggacacagtgatccct
cactggcacgaccgccccatggaccccgatgccgagagacttgcgtctccggttctgtat
gcagtactcaagtaccagtgggaggtcggtttgcagccggcgatgcgaaacactgaccga
accatcgccgagagaacgctgtactgccttcgcaagttcactgacgagacggcccacagg
gtagagagcgcaagacaccaaatagccgcttccacccaggccggtaacggtgcaattgac
ggcttacatcaggcctctaccttttccgagttcgacgaggcggcattactcagcccggat
gtgcagcgtcactggacagaacaaacggtgctgcttgccaagtgctacctccgccagggc
gattggatgattgccctgaacaaggacgattggcaatacacacggcgcaaagacatcctc
tcctgctactacaaggccacctattatcatcgccactggtacaaggcctggcatgcctgg
gccttggccaacttcgaagtggtgcaggcccttggatctcgcaaggacctagacagcggc
gtcatcatccagtatgccgtgcctgctgtgcatggttttttcgagtctatttcgctctct
tcgggaagctctctgcaagacacgctgcgtttgctcacactctggcttacatatggtggc
aaccccgatgtcgccagtactgtgacagagggcttcagtcgtgtcagcgttgatacctgg
cttgaggtcattccacagttgatcgctcgcattacccaacctaacaagaaggttcaggcg
tcgatccatgctctgttgtctgatgtcggtcgtgcgcacccccaggcgttagtctacccc
ttgacggttgccatgaagtcgcgacaaagcacgcgcaggtccaagaccgccagcctcatt
atggagacaatccgtcagcacagtaataagctggtcgagcaggcagagacggtgagccgc
gagcttattaggaccgcggtcctctggcacgagctatggcatgagggtctggaggaggct
tcccggctctactttggcgatcacaatatcaagggaatgtttgatgccctcgagcccctt
cacgacctgctcgaaaagggccctcaaaccctccgggaggtttcatttacacagacgttc
ggccgtgatctgggtgaggctcgcgagtggtgccggcaatatcgcgaaacagaggacgtc
aatgacctgaaccaagcctgggacttgtactaccaggttttccgtcgtatcagccgacag
cttccacagatgaccacactggagctgacctactgctctccggacctgctccaggccagg
gacctggagctcgcggtgccgggaacgtatcgcagtggccaagaggttgtccgaatcatg
tcttttgacggcacctttacggtcatcagcagcaagcaacgtccgcgaaaacttgacatt
gttggaagtgacggtaagacgtacactttcttgctcaaaggtcatgaggacatcaggcag
gatgagcgtgtcatgcagctcttcggcctctgcaacacgctcttggccaacgactcggaa
tgctacaagcgccatctcaacatccaacgttacccggctattccgctgtcgcagaattcg
ggtcttctcggctgggtcccagacagcgacacgatccaccagcttatccgtgattatcgg
gagtcaagaaagattctccttaacatcgagcatcggatcatgcttcagatggcgcccgac
tacgataacctcacactcatgcagaaggtggaagtgtttgggtatgcccttgataacaca
acgggtcaggatctgtaccgggtcttatggctgaagagcaagagctccgaagcctggtta
gacaggcgaactaattacacgcgttccctcggcgtcatgtcgatggtcgggtacatcctg
ggcttgggcgaccgtcatccgagcaacctgatgctggaccgcatcacgggcaagatcatt
cacattgactttggcgactgctttgaggtggcgatgaagcgtgagaagtacccggagcgg
gtgccttttaggcttacccgcatgcttacttatgccatggaggttagcaacatcgagggc
agcttccggattacatgcgaacacgtgatgagagtcttgcgtgacaataaggagagcgtt
atggccgttctcgaggctttcattcacgacccgctactcacgtggcgtcttaccaacccg
gccagtcccgctggaccacatttcaattcggagagagagcaagctattgccgggccccag
gcagcacgggtgcgtcggccttccatactggaggctccgatggccccgactgagttcctg
gcagctcaagctggtcccgaaggcttgaccggggcgcgtagccgtgcgcgtacaaactca
tccgccgcgccgctcccaagcataaccaatgacggtgtccatggccccatcgagattgcg
gaggtgcaaaatgcgcgggctgtcgaagtgcttgaccgggtctcccagaaactcacgggt
cgtgatttcaagccgaacgaagagcttcttgttaaagatcaggttaataagctgatcatt
gaggctaccaagcttgagaatctctgccagcactatatagggtggtgcagcttttggtga

DBGET integrated database retrieval system