KEGG   Podospora anserina: PODANSg09886Help
Entry
PODANSg09886      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pan  Podospora anserina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pan00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1571 aa AA seqDB search
MIPKTMVSNEVYLLPLNDDGSPQVAGEYIYLAPKTNDPVTIRFAIEGTSSICRHGSLWVN
IPEQGQEFRRDKFREFKLVPDFNRTLEISIPIYEAGAYAFYTTYAELPDLANNLKPQTNG
NAKVQTKQTPTYYIDVAPRLSLDGQPLPLPALSVFSIISKFMGKYPNDWEKHLRGISDRG
YNMVHFTPLQVRGDSNSPYSLYDQLGWDPVCFPGGEKDVKKLVDSLEKNHSLLSLTDIVL
NHTAHNSEWLLEHPEAGYNLTTAPWLESAYLLDTKLLELGFKLGDLGLPTELKSVDDLVL
IMGAIKKEVIAEIRLWEYYVLDVERDADAAVESWVVGRTNFPDGSIGSHGLDGLRSTSLE
EQAQWITKHGLQNMDRLGERFRRRADPSVAAALLSVLFGKYEGNKGSAADQAAARNALVK
ILDVVNVPFYEEYDAEVADTLQQVFNRIKYVRLDDNGPKLGPINQANPLIETYFTRLPLN
EKTKKHRKEDLVLVNNGWVWGGNALVDNAGPESRVYLRREVIVWGDCTKLRYGAGPQDSP
WLWEHMTKYARMLAKYFAGFRIDNCHSTPLHVAEHILDEARRVRPNLYVVAELFTGSEEM
DYVFVKRLGISSLIREAMQAWSTGELSRLVHRHGGRPIGSFEVDEISSADVRSASKTNGT
NGTNGANGHYTREIIRRIKPVPVQALFMDCTHDNEVPAQKRDARDTLPNAALVSMCASAT
GSVMGYDEIYPRLIELVHETRLYTSESSKFPVKVGEGKGGIAGVKKLLNQIHTLMGMDGY
DETHIHHEDQYVTVHRVHPVSRKGYFLIAHTAFPGYGNGNGAFNPVHLTGTKAKHIGSWM
LEVDASKEAVEEVLSDKKLLRGLPSRLIGLPGVRMEVKGQDTIITVREKFPPGSIALFET
WIPAAEHSSGLDTFVTSGAKAAMAELDLVDLNFLLYKCEPEERDASEGRDGVYDIPGHGK
LVYAGLQGWWSIMKDITRDNNLAHPLCQNLRDGQWALDYTLGRLERAAKKENYKRLGKPA
AWLKERFDAIRGIPSFLLPRYFALVLRTAYMAAFKRGISLMNNNVQKGQWFLQSLSMVSV
QQTGLVKSASLYPDRLVPSLAAGLPHFAVEWARCWGRDVFISLRGLYLGTGRFDEAKEHI
RAFASVLKHGMIPNLLGSGNTPRYNARDSVWFFLQCIQDYTRIVPDGLSLLDEKVKRRFL
PYDDAYFDTADTRAYSKESTIREIIQEVFQRHAEGMKFREANAGPNLDMQMSDNGFNQEI
KVDWSNGFVFGGNQDNCGTWMDKMGESERARSKGVPGTPRDGAAVEITGLLYSGLKWFAS
LHEQGKHDQSGVRKADGSTITFKDWAALIKKNFERCYFIPISSEDDKDYDVNPAIINRRG
IYKDLYKSGKEYEDYQLRPNFPIAMTAAPDLFVPEHAMHALCIADSALRGPTGMATLDPS
DLNYRPYYRNSEDSDDFATSKGRNYHQGPEWLWPTGFFLRALLKFDLMRRGKEDAEGRTE
AFQQVTRRLIGCKEMIERSPWAGLTELTQKGGEECADSSPTQAWSAGCLIDLYMDAAEEQ
AILEAKSLPLR
NT seq 4716 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaaaaccatggtttccaacgaggtttacctgctgccactcaacgatgatggc
tcgccccaggtcgccggcgagtacatctatctggcacccaagaccaacgaccccgtgacc
attcgatttgccatcgagggcacatcgagcatctgccgccatggcagcttgtgggtcaac
attcccgaacagggacaagagttccgccgggacaaatttcgagagttcaagcttgtcccc
gatttcaaccgcacacttgagatctcgatccccatctacgaagccggtgcttatgccttt
tacaccacatacgccgagctgcccgaccttgcaaacaacttgaagccccagacaaatggc
aatgccaaggtccagaccaaacagacaccaacatactacatcgatgttgcaccacggctt
tctctcgatggtcaaccactgccgctgcctgcactgtccgtattctctattattagcaag
tttatgggcaagtatcccaatgactgggagaaacatctccgtggcatcagcgacaggggc
tacaacatggtccacttcacgccactgcaagtgagaggtgactcgaattccccatacagt
ctctacgaccagctcgggtgggacccagtctgtttccctgggggtgagaaggatgtgaag
aagttggtcgatagcctcgaaaagaaccactctcttctcagcttgaccgacatcgtcctc
aaccacacagcacacaacagcgagtggcttctggagcacccagaagctggctacaatctc
accacagcaccatggctcgagtcggcatatcttctggacaccaagctgctcgagttgggc
ttcaagctgggagacctcgggttgcctacggaactcaagtctgttgacgatttggtgctg
atcatgggtgcgatcaagaaggaggtcattgctgagatccgcctctgggagtactatgtt
ctggacgtcgaacgggatgctgatgcggctgtcgaatcttgggtcgttggccggaccaac
ttcccagacggttccatcggcagccatggtctagacggccttcgctctacttcccttgag
gaacaagcgcaatggatcaccaagcatggtcttcaaaacatggatcgtctaggagagcgt
tttaggaggcgtgccgaccccagtgtggctgcggccctcttatccgttctgtttggcaag
tacgaaggcaacaagggcagcgctgccgaccaagccgctgctcgcaacgcccttgtcaag
atcctagacgttgtcaatgtgcccttctacgaggaatacgacgctgaagttgccgatact
ctccagcaggtcttcaaccgtatcaagtatgtccggttggatgacaacggcccaaagctt
ggaccgatcaaccaggcgaaccccttgattgagacctacttcactcgtctgcctctgaat
gagaagaccaaaaagcacaggaaggaggacttggtgcttgtgaacaacggctgggtctgg
ggtggaaatgctctggtcgacaatgccggccctgaatcccgagtctaccttcgccgtgag
gttatcgtctggggtgattgcaccaagctcagatatggtgccgggcctcaagacagccca
tggctgtgggaacacatgaccaagtatgctcgcatgttagccaagtactttgccggcttc
cgcattgacaactgccactcgactcctcttcacgttgccgagcacatcctcgacgaggct
cgccgcgtgagacctaatctatatgttgtcgccgagctctttacgggctccgaggagatg
gactatgtctttgtcaagagacttggcatcagctctctcattcgtgaggccatgcaggcg
tggagcactggtgagctgagtcgtcttgttcaccgtcatggtggtcgccccattggcagc
ttcgaggtggatgagatctcgagtgcggatgttcgcagtgcctccaagaccaacggcaca
aacggtaccaatggtgcgaacggacattacacacgtgagatcattcgccgcatcaagcca
gttcctgtccaggcactcttcatggactgcacccacgataacgaggttcctgctcagaag
cgcgatgcccgtgacacgctgcccaatgctgcccttgtcagcatgtgcgcgagtgccacc
ggcagcgtcatgggttacgacgagatctatcctcgtctgatcgagcttgtccacgagacc
agactgtacacatccgaatcttccaagttcccagtcaaggtcggcgaaggcaagggtggc
atcgctggtgtcaagaagcttctcaatcagatccacaccctgatgggtatggatggttat
gatgagacgcatatccaccacgaagatcagtatgtcactgttcacagagttcacccagta
tctcgcaagggatacttcctcattgcccataccgcgtttccgggatatggaaacgggaat
ggcgctttcaaccccgtccacctgaccggcaccaaagccaaacacattggtagctggatg
ctcgaggttgatgcaagcaaggaggctgtggaagaggttctgagcgacaagaagctgctc
cgtggccttcccagtcgtctaattggtctccctggcgttcgtatggaggtcaagggccaa
gacaccattatcactgtccgcgaaaagttccctcctggcagcattgcgctctttgagact
tggatccccgcggcggagcactcgagtggtttggacacctttgtcacgtccggagccaag
gccgcgatggccgagcttgacctggttgatctcaacttccttctctataagtgcgagccg
gaagaacgtgacgccagcgaggggagagatggcgtctatgacattcccggacatggcaag
cttgtctatgctggccttcagggctggtggagcatcatgaaggatatcaccagggacaat
aacctggctcacccactgtgccaaaaccttcgtgatggacagtgggcgctggactatacc
ctgggtagacttgagcgtgcggccaagaaggagaactacaagcggttgggtaagcctgct
gcctggctcaaggagcggttcgatgccatccgtggtattcctagcttccttctcccgcgg
tactttgccctggttctcaggactgcgtacatggctgcattcaaaaggggcatttccctc
atgaacaacaatgttcagaaggggcaatggttcctccaaagcctcagcatggtgagcgtt
cagcagactggtcttgtcaagtccgcctcgctctaccctgatcgcctggtcccatcgctc
gctgctggccttcctcactttgctgttgaatgggctcgctgctggggacgcgacgtcttc
atctctctccgtggtctctacctcggtaccggtcgcttcgatgaggccaaggaacacatc
cgtgcctttgctagtgtgctgaagcacggcatgatccccaaccttctcggtagtggtaac
actccgcgatacaacgccagagactctgtttggttcttcttgcagtgcatccaagactac
actcggatcgttcctgatgggctgtcgctgcttgacgagaaggtcaagagacggttcctg
ccatatgacgacgcctactttgataccgccgacactcgtgcctacagcaaggagagcacc
atccgcgagatcatccaggaggtctttcagcgccacgccgagggcatgaagttccgcgag
gccaatgccggccctaaccttgacatgcagatgagtgacaatggcttcaaccaagagatc
aaggtcgactggtccaacggttttgtgtttggtggcaaccaagacaattgcggcacttgg
atggacaagatgggcgaaagcgaaagagctcgctccaagggcgtcccgggcactccccgt
gacggcgccgccgttgagatcaccggtctgttgtacagcggtctcaagtggtttgcctcc
ctccacgagcaaggcaaacacgaccaatccggcgtcagaaaagccgacggctcaaccatc
accttcaaggactgggccgctctcatcaagaagaactttgagcgctgctactttatcccc
atctcttccgaagacgacaaggactacgacgtcaaccctgccatcatcaaccgccgtggc
atctacaaggacttgtacaaatccggcaaggaatacgaggactaccagctccgtcccaac
ttccccattgccatgaccgccgccccggatctgtttgtccctgagcatgccatgcacgcg
ctttgcattgcggactctgctcttcgcggcccgacgggcatggctacgcttgacccgagc
gatttgaactataggccttattaccgcaacagtgaggacagtgatgattttgcgacgagt
aaagggaggaactatcaccaggggccggagtggttgtggcctacggggttcttcttgagg
gcgctgctcaagtttgatctgatgagaagggggaaggaggatgcggagggaaggacggag
gcgttccagcaggtgacgaggagactgattgggtgtaaagagatgattgagcggagccca
tgggcggggttgaccgagttgacgcagaaggggggggaggagtgtgctgattcttcacct
actcaggcttggtcggcgggttgcttgattgatctttatatggatgctgcggaggagcag
gcgattttggaggcgaagagtttgcctctgaggtag

DBGET integrated database retrieval system