KEGG   Podospora anserina: PODANSg09965Help
Entry
PODANSg09965      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PODANSg09965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 355 aa AA seqDB search
MASATRTFARALRTSARPAINAAPRAAFRQSARFYSAKPTGGSSSNGLLYGLAGAGLLGG
GAFYLYSNDSNVAPKLFVPKFEDYQKVYNEIASRLEEKEDYDDGSYGPVLVRLAWHASGT
YDKETGTGGSNGATMRFSPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWILAGVCAI
QEMMGPTIPYRAGRQDRDVAACTPDGRLPDAAQAQDHLRNIFYRMGFNDQEIVALCGAHA
LGRCHTDRSGYSGPWTFSPTVLTNDYYKLLLEEKWQWKKWNGPKQYEDKKTQTLMMLPAD
MAIIQDKKFKEWVKVYAADNDKFFEDFSAVVKKLFELGVPFKEGTETWTFKPVNA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgctactcgcaccttcgcccgcgctctgcgcacctctgctcgcccggctatc
aacgccgctccccgcgccgctttccgccagagcgcccgcttctactccgccaagcccacc
ggtggcagctccagcaacggcctcctctacggccttgccggtgccggtctcctcggcggt
ggtgctttctacctctacagcaacgacagcaacgtcgcccccaagctgttcgtccccaag
ttcgaggactaccagaaggtgtacaacgagattgccagccgtctcgaggagaaggaggac
tacgatgatggcagctacggccccgttctcgtccgtctcgcttggcacgccagcggtacc
tacgacaaggagaccggcactggtggcagcaacggcgccactatgcgcttctctcccgag
agtgaccacggtgcaaacgctggtctcaaggctgcccgtgacttccttgagcctgtgaag
gccaagttcccctggatcacctactccgatctttggattcttgccggtgtttgcgccatc
caggagatgatgggccccaccatcccctaccgtgccggccgccaggaccgtgacgtcgct
gcctgcactcctgatggccgtcttcccgatgccgctcaggcccaggaccacctccgaaac
atcttctaccgcatgggcttcaacgaccaggagatcgtcgctctctgcggtgcccacgct
ctcggccgctgccacaccgaccgctccggctactcgggcccctggaccttctcccctacc
gtcctgaccaacgactactacaagcttctccttgaggagaagtggcagtggaagaagtgg
aacggccccaagcagtatgaggacaagaagacccagaccctcatgatgcttcccgccgac
atggccatcattcaggacaagaagttcaaggagtgggtcaaggtttacgccgccgacaac
gacaagttcttcgaggacttctccgccgtcgtcaagaagctctttgagcttggtgttccc
ttcaaggagggcactgagacctggaccttcaagcccgtcaacgcctaa

DBGET integrated database retrieval system