KEGG   Podospora anserina: PODANSg10018Help
Entry
PODANSg10018      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PODANSg10018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 500 aa AA seqDB search
MMDVDSYRWRPPKTNYLPHNIDMDPVVEEFEIPLGRASDHENAAYFEKMKLAAQEFNIVR
PKGYTVSYHATSEMEKHHFGQTHPMKPWRLTLTKSLVTAYGMPFAMDNYNTRHATYEELN
SFHSSDYLDYLATAAPEDQPRDLDNPDKDVKFNLGGSDCPLFHGLYDYCSMSAGTSLDAA
RKICNKQSDIAIAWGGGLHHAKKSEASGFCYINDIVLAILQLLRLYPRVLYIDIDVHHGD
GVEEAFFSTDRVMTVSFHKYQPEVFFPGTGGLNDNGPKSEHNPGAHHAINVPLNDGITDE
QYEHLFKSIIGQVNTTFRPSAIALQCGADSLAGDRLGRFNLKVEGHAACVRFCKSLGIPM
ILFGGGGYTPRNVARAWAYETSIAIGADQNIPAEIPQHAPWRQHFVHETLFPTLEQSMSE
PRNNKNTEKRLRDIVAHVHEQLRFVQHAPSVQSSIIPPDLGPVRDEVEERFKEERGEREG
DEVERRVKEQGLGVEGEMAV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgtcgattcgtaccgctggcgtccgccaaagacaaattacctccctcacaac
atcgacatggatccagtcgtggaggaattcgagatcccactcggaagggccagcgaccac
gaaaacgccgcctactttgagaaaatgaagctcgccgcccaagagttcaacatcgtcaga
cccaaagggtacacggtctcataccacgcgacctccgagatggaaaagcaccattttggc
caaacccacccaatgaagccctggcgtttaactctcaccaaaagcttggtgacagcctat
ggcatgcccttcgccatggacaactacaacacccggcacgccacctacgaagagctgaac
tctttccactcgagcgattatctggactacctcgcgacggccgccccagaggaccaaccc
cgagacctggataaccccgacaaggacgtcaagttcaacctcggcggttccgactgtccc
ctcttccacggtctctacgactactgctccatgtcagccggcacctccctagacgccgcc
cgcaaaatctgcaacaaacaatccgacatcgccatcgcctggggcggtggccttcaccac
gccaaaaagtccgaagcctccgggttctgctacatcaacgacatcgtcctcgccatcctc
cagctcttgcggctctacccccgcgtgttatacatcgacattgacgtccaccacggcgac
ggcgtagaagaggccttcttcagcaccgaccgcgtcatgaccgtctcgttccacaagtac
caacccgaagtcttttttcccggcaccggcgggctgaacgacaacggtccgaaatccgag
cacaaccccggagctcaccacgccatcaacgtccccctcaacgacggcatcacagacgag
cagtacgagcacctgttcaagtccatcattgggcaagtcaacaccacgttccgcccgagt
gcgatcgccctccagtgcggcgccgactctcttgcgggcgaccgacttggtaggttcaat
ctgaaggtagagggtcacgcggcctgcgtgaggttttgcaaaagtctaggcattcccatg
attttgtttggtgggggggggtacacgccccgaaacgtggccagggcgtgggcgtacgag
acctccatcgcgattggcgccgaccagaacattccggcggagatcccgcagcatgcgccg
tggaggcagcactttgtgcacgagacgcttttcccgacgctggagcagagtatgagtgag
ccgaggaataacaagaatacagagaagaggctgagggacattgtggcgcatgtgcatgag
cagttgaggtttgtgcagcacgcgccgagcgtgcagagcagtattatcccgccggatttg
gggccggtgagggatgaggtggaggagaggtttaaggaggagaggggggagagggagggg
gatgaggtggagcggagggtgaaggagcaggggttgggagtggagggggagatggctgtt
tag

DBGET integrated database retrieval system