KEGG   Podospora anserina: PODANSg10020Help
Entry
PODANSg10020      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pan  Podospora anserina
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PODANSg10020
   00052 Galactose metabolism
    PODANSg10020
   00500 Starch and sucrose metabolism
    PODANSg10020
   00520 Amino sugar and nucleotide sugar metabolism
    PODANSg10020
Enzymes [BR:pan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PODANSg10020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 522 aa AA seqDB search
MAQAIKSALPSHLKPGNGDEQEFAKRHHGKTRSHMAFENTSTNIAAAQMRNALTNLAETV
KDPKEKKLFETEMDNFFSLFRRYLNDKAKGNEVSWDRIAPPAAGQVVDYEDLAHSESVGF
LNKLAVLKLNGGLGTSMGCVGPKSVIEVRDGMSFLDMSVRQVEHLNRSYGSNVPILLMNS
FNTHDDTAAIIKKYEGHNVDILTFNQSRYPRIFKDSLLPVPKSFDSALHDWYPPGHGDVF
ESLYNSGVLDQLIDRGIEIIFLSNADNLGAVVDLRILQHMVESEAEYIMELTNKTKADVK
GGTIIDYEGSVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMNVKAIKRVVENNELEME
IIPNGKTIPGDKKGESDISILQLETAVGAAIKHFKNAHGVNVPRRRFLPVKTCSDLMLVK
SDLYTVKHGQLQMSTARFGDAPLIKLGGDFKKVSDFQKRIPSIPKIIELDHLTITGAVNL
GRGVVLKGTVIIVATEGQTIDIPPGSILENVVVQGSLRLLEH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcgattaagagcgctctcccatcccacctcaagcccggcaacggcgacgag
caggagtttgccaagagacatcatggcaagactcgttcccacatggctttcgagaacacc
tcgaccaacattgctgctgcccagatgcgcaatgctctcaccaacctcgccgagaccgtg
aaggaccccaaggagaagaagctgttcgagaccgagatggacaacttcttctccttgttc
cgccgctatctcaatgacaaggctaagggcaacgaggtctcgtgggaccgcattgctcct
cccgctgctggccaggtcgtcgattacgaggacttggcccactccgagtctgttggcttc
ctcaacaagcttgctgttctcaagctcaacggtggtctcggtacctccatgggttgcgtt
ggtcccaagtcggtcatcgaggtccgtgatggcatgtctttccttgacatgtccgtccgc
caggtcgagcacctcaaccgcagctacggctccaacgtccccattctcctcatgaactct
ttcaacacccacgatgataccgcggcgattatcaagaagtatgagggtcataacgtcgac
attcttacctttaaccagtcgaggtaccccagaatcttcaaggactccctcctcccagtc
cccaagtcctttgactctgctctccatgactggtatcctcccggacacggtgacgttttc
gagtccctctacaactctggtgttcttgaccagctcatcgaccgtggcatcgagatcatc
ttcctttccaacgctgacaacctcggcgccgttgttgatctccgcattctccagcacatg
gttgagagcgaagccgagtacatcatggagttgaccaacaagaccaaggccgatgtcaag
ggtggtaccatcattgactacgagggcagcgtccgccttctcgaaatcgcccaggtcccc
aaggagcatgtcaacgagttcaagtccatcaagaagttcaagtacttcaacaccaacaac
atctggatgaacgtcaaggccatcaagcgcgtcgtcgagaataacgagctcgagatggag
atcatccccaacggcaagaccatccccggtgataagaagggcgagtcggacattagcatt
ctccagctggagaccgctgttggtgctgccatcaagcacttcaagaacgcccacggtgtc
aacgttccccgtcgccgcttcttgcccgtcaagacttgctctgatctgatgcttgtcaag
tctgatctctacaccgtcaagcacggccagctccagatgagcacagcccgcttcggtgat
gctcctctgatcaagctcggtggtgacttcaagaaggtgtccgacttccagaagcgcatc
cccagcatccccaagatcattgagcttgaccacctcaccatcaccggtgcggtcaacctt
ggtcgcggtgtcgtcctcaagggtaccgtcatcattgtggcgacagagggtcagaccatc
gacattcccccaggatccatcctcgagaacgttgtcgtccagggtagcttgcgtctgctt
gagcattaa

DBGET integrated database retrieval system