KEGG   Podospora anserina: PODANSg10108Help
Entry
PODANSg10108      CDS       T01048                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
pan  Podospora anserina
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pan04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1683 aa AA seqDB search
MAAPNLPIKFQELLQLSSLGVGPTAITFNTCTLESDSYICIRDKKDEASSPEVIIVDLKN
GNNVIRRPIKADSAIMHWTRQVIALKAQSRTLQIFDLEQKQKLKSTQMSEDVAFWKWISE
TTLGLVTETSVYHWDVFDPTQAAPVKVFDRHSNLTNNQIINYRTSADGKWMAVVGISQQQ
GRVVGAMQLYSKDRGITQAIEGHAAAFGTIRLDGAPEDTKLFTFAVRTASGAKLHIVEID
HPETNPVFQKKAVDVFFPPEAGSDFPVALQVSQKYGIIYLITKYGFIHLYDLETATCIFM
NRISGETIFTACGDSNSTGVVGINRKGQVLFVSADENKIVPYVLESHGTELALKLASRAG
LPGADNLYQQRFEQLFSNGSYQEAAKVAANSPRGFLRTPQTIERFKRLPQQPGSMSHILQ
YFGMLLDKGALNQHETLELAQPVLAQNRKQLLAKWLEENKLECSEQLGDMVRPHDMPMAL
SIYLKGNVPNKVVAGFAELGQFDKILPYCTQTGYQPDFIQLLHHIVRVNPEKGAEFATAL
ANNEGGSLVDLERVVDIFQSQGMVQQATAFLLDALKDNKPEQGHLQTRLLEMNLLNAPQV
ADAILGNDMFSHFDKAQIAKLCEQAGLFQKALELYEDPAAIKRVVVGIAGAPNFNPEWLI
EYFGRLSVEQSIDCLDAMLKHNIRQNLQSVVQIATKYAELLGPQRLIDLLEKYKTAEGLY
YFLGSIVNVTDDSEVVFKYIEAATKTGQIREVERICRDNSVYNPEKVKNFLKEAKLSEML
PLMVVCDRFNFVHDLVLYLYQHQQFKSIEVYVQQVNPSRTPGVIGGLLDVDCDENIIKNL
LSTVNPVSIPIDELVQEVETRNRLKLLLPFLEATLAAGNQQQAVFNALAKIYIDSNNNPE
KFLKENDQYDTLTVGKYCEKRDPNLAYIAYSKGLNDLELVNITNENAMYKAQARYLLERG
DNDLWMFVLSENNLHRRSVVDQVISTAVPESTDPAKVSLAVQCFLSADLPAELIELLEKI
VLEPSPFSDNPNLQNLLMFTAAKADKARVMDYIHRLDNFSADEISNVCIEVGLFEEAFEV
FKKIDNKEAAVNVLVEHVVSIDRAQAYAEEVDIPQVWSRVAKAQLDGLRVSDSIESYIKA
EDPKNYEEVIEIAVAAGKNEELIKYLRMARKTLRESAIDTALAFCYARLDQLAELEDFLR
ATNVANIEESGDKAYAEGFFEAAKIFYTSISNWAKLATTLVHLEDYQAAVDCARKANNIK
VWREVHEACVGKKEFRLAQICGLNLIVDAEQLQALVKQYEREGYFDELISLLEQGLGLER
AHMGMFTELGIALSKYHPERLMEHLKLFWSRMNLPKMIRACEEANLWPELVFCYYHYDEF
DNAALAVMERPENSWEHQQFKEITVKVANLEIYYKAINFYLEQHPSLLTDLLQVLTPRID
VNRVVRMFQKSDNLPLIKPFLLSVQSQNKRTVNDAINDLLIEEEDYKTLRDSVENYDNYD
AVELAGRLEKHDLVFFRQIAANIYRKNKRWEKSINLSKQDKLWKDAIETAAISGKTDVVE
ELLRYFVDIGNRECYVGMLYACYDLIRPDLILELSWRNGLHDFTMPYMINLLCQQTKELA
ALKADNEARKAKEAAEKTEDDNTPILGMNRLMITAGPAQGRASPASFGGQTNGFAPQPTG
FGF
NT seq 5052 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcctaatctacccatcaaattccaggagctgctccagctcagcagcctgggt
gttgggccaactgctatcacattcaacacttgcacattagaatcagactcgtacatctgc
atccgagataagaaggacgaagcctcttcccccgaagtcatcatcgtcgacctcaagaat
ggcaacaatgtcattcgccggcccatcaaggccgacagcgccatcatgcactggacgcgt
caggtcatcgccctcaaggcccaatcgcgaacactgcagatcttcgacctcgagcagaag
cagaagctcaagtcgacccagatgagcgaggacgtggccttctggaagtggatcagcgag
accacgctcggcttggtgacagagacatccgtctatcattgggatgtttttgatccgacc
caggcggcacctgtcaaggtgtttgaccgccacagcaacctcacaaataaccagatcatc
aactatcggacgagcgctgatggaaagtggatggccgtcgttggcatttcgcagcaacaa
ggccgcgttgttggagccatgcaactgtattcgaaagaccgcggcattacccaggccatt
gaaggccatgccgctgcctttggcactattcgtctcgacggtgcccccgaggacaccaag
ctgttcaccttcgccgtgcggaccgcctctggagccaaacttcacatcgtggaaattgac
cacccggaaacgaatcctgtcttccagaagaaggcagttgatgtgttcttcccgccagag
gccggcagtgacttccccgttgcgcttcaagtgtcacagaagtatggtatcatttatttg
atcaccaaatacggattcattcatctctacgacctcgaaactgctacatgtatcttcatg
aaccgcatctcgggcgagaccatcttcacagcttgtggcgacagcaattcgactggtgtc
gtcggtatcaatcgcaagggtcaggtactcttcgttagcgccgatgaaaacaagatcgta
ccctatgtgttggaaagccacggcaccgagctggccctcaagctggcgtcgcgtgctggt
ctgcccggtgctgacaacctctatcagcaacggttcgagcagctgttcagcaacggaagc
taccaggaggctgctaaggtcgccgccaactcgccccgtggtttcctgcggacaccccag
acgatagagcgtttcaagcggcttccgcagcagcctggctccatgtcgcacatcttgcaa
tatttcggcatgcttcttgacaagggtgctctgaaccagcacgaaacccttgagcttgct
caacccgtgcttgcccagaaccggaaacagctcctggcgaagtggctggaagagaacaag
ctcgagtgctccgagcaacttggtgacatggtccgcccgcatgatatgcccatggccctc
agcatctacctgaagggcaatgtgcccaacaaggttgtcgctggctttgccgagttggga
cagtttgataagattctcccctactgcactcagactggctatcaaccagactttattcaa
cttttgcaccacatcgtccgcgtgaacccagagaagggtgccgagttcgcgacagcactt
gccaacaatgaagggggctcgcttgttgacctcgagcgcgtcgtggatatcttccaatcg
cagggcatggtgcagcaggctaccgctttccttctcgatgctctcaaggacaacaagcct
gagcaaggccatctccagacccgcctcttggagatgaaccttctcaatgccccccaggtt
gctgatgctatcctcggcaacgacatgttctcccacttcgacaaggcgcagattgccaag
ttgtgcgagcaagcaggattgttccaaaaggctctggagctctacgaggaccccgcagcc
atcaagcgtgttgtcgtaggcattgccggggcgccaaacttcaaccccgagtggttgatt
gagtacttcggtcgcctttccgtcgagcaatccattgactgcctcgatgctatgttgaag
cacaatatccgccaaaacctccagtccgttgtgcagattgccaccaagtatgccgagctt
ctcgggccccagcgtcttattgacctgcttgagaagtacaagaccgccgaaggtctttac
tacttccttggtagcattgtcaacgttaccgatgattctgaggttgtcttcaagtacatc
gaggctgctaccaagacgggtcagatccgcgaggttgagcgcatttgccgtgacaacagc
gtctacaacccagagaaggtcaagaacttcttgaaggaggccaagctcagcgagatgctt
ccactcatggtggtgtgcgatcgtttcaactttgtacacgacttggtcctctacttgtac
cagcaccagcagttcaagtccatcgaggtgtatgtgcagcaagtcaacccttcgaggact
cccggtgttattggcggcttgttggatgtcgactgcgatgagaacatcatcaagaacctt
ctcagcacagtcaacccagtatctatccccatcgatgagcttgtccaggaggtcgagacc
cgcaaccgtctcaagttgcttcttcccttcctcgaggcgaccctggctgctggcaatcag
cagcaggcagtgttcaacgctttggccaagatttacatcgactccaacaacaatcctgag
aagttcctcaaggagaacgaccagtacgacaccctcactgtcggaaagtactgcgagaag
cgcgatcccaacctcgcctacattgcctatagcaagggcctgaacgaccttgagctcgtc
aacatcaccaacgagaacgccatgtacaaggcccaggccaggtacctgcttgagcgtggt
gataatgacctctggatgttcgttctcagcgagaacaacctccaccgccgttccgtggtc
gaccaagtcatctcgaccgctgttcccgagtcgacggatcccgccaaggtttctcttgcg
gttcaatgtttcctgagcgctgatcttccagctgagctcattgagctgctcgagaagatt
gtcttggagccatcacccttcagtgacaacccgaacttgcagaatttgctcatgttcact
gctgccaaggctgacaaggcccgcgtgatggattacatccatcgtcttgacaacttctcc
gcggatgagatttctaatgtctgcattgaggttggtctgttcgaggaagccttcgaggtt
ttcaagaagatcgacaacaaggaggcggctgtcaacgtactcgttgagcatgtggttagc
atcgatcgtgctcaggcttatgccgaggaggtcgacatccctcaggtttggagcagagtc
gccaaggctcagcttgacggtctccgtgtcagcgactcgatcgagtcttacatcaaggcg
gaggaccccaagaactacgaggaagttattgagatcgctgtggctgctggcaagaatgag
gagctcatcaagtatctgcgcatggcccgcaagacccttcgcgagtctgccattgatact
gctcttgccttttgctatgctcgccttgatcaacttgccgagctcgaggacttcctgcgg
gctactaatgtcgccaacattgaagaatccggagacaaggcttacgccgagggcttcttc
gaggcggccaagatcttctataccagcatttccaactgggcgaagttggctaccacattg
gtacatcttgaggattaccaagctgctgttgactgcgcgcgcaaggccaacaacatcaag
gtctggagagaagtccatgaggcttgcgttggcaagaaggagttccgtctggcccagatc
tgcggtctcaaccttatcgttgatgctgagcagcttcaggctttggttaagcagtatgag
cgtgagggctactttgacgagctcatcagtcttcttgagcaaggtcttggcttggagcgt
gcccacatgggtatgttcaccgagcttggcattgccctttccaagtaccaccctgagcgg
ttgatggagcacctcaagctcttctggagcagaatgaacctgcccaagatgatccgtgct
tgcgaggaggccaacctctggcctgagctggtcttctgctactaccactatgatgaattc
gacaacgctgctcttgcggttatggagcggccggaaaactcctgggagcaccagcagttc
aaggagatcaccgtcaaggttgccaaccttgagatctactacaaggccatcaacttttac
cttgagcagcatccttcgctccttaccgaccttctccaggtcctcactcctcgcatcgat
gtcaaccgtgttgtccgcatgttccagaagtccgacaacttgcctctgatcaagccattc
ttgctcagcgttcagtcgcagaacaagcgcactgttaacgatgccatcaacgatcttctg
atcgaggaggaggactacaagactctccgcgactctgtcgagaactacgacaactatgac
gctgtcgagctcgccggtcgcctcgagaagcacgatctcgtcttcttccgccaaattgcc
gctaacatctaccgcaagaataagcgctgggagaagtcgatcaacctgtccaagcaggac
aagttgtggaaggatgccattgagactgctgccatctctggcaagaccgatgttgttgag
gagcttctccgttatttcgtcgacattggcaacagggagtgctacgtcggcatgctttat
gcctgctacgacctcatccgccccgatcttatcctggagctctcttggcgcaacggcctc
catgacttcactatgccgtacatgatcaacctcctctgccagcaaaccaaggagttggcc
gccctcaaggctgacaacgaggctcgcaaggccaaggaggctgccgagaagaccgaggat
gacaacacccccatcctgggcatgaaccgcctcatgatcaccgctggtcccgctcaaggc
cgggcctctcccgcgtcttttggcggacaaaccaacggatttgcgccccaacctaccggt
ttcggattctag

DBGET integrated database retrieval system