KEGG   Podospora anserina: PODANSg1040Help
Entry
PODANSg1040       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pan  Podospora anserina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PODANSg1040
Enzymes [BR:pan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PODANSg1040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 345 aa AA seqDB search
MKLLNFLLGAAAVGSALAAPAPAPVCDAPTKRATKFQFVGVNQSGAEFGKDTLPGQLGKH
YTWPVRSSIDALMGKGFNTFRIAFMMERIVPNKLDGPLDATYASGLTDLQIVNYVTSKGA
YAIIDPHNFGRYYNNVITDVAGFAAWWTTIAKLFVNNDKVIFDTNNEYHDMADDLVRRLN
QAAIDAIRATGATAQYIMVEGNSWTGAWTWVSSGNGANLLSLRDPADSTGEKIIYQMHQY
LDSDGSGTSETCVSRTIGAERVRAATEWLKQNKKKGFLGETAGGANTNCIAALTGMLSYL
QQNNDVWTGWAWWGGGPWWGNYMFAMEPPSSVAYDRVLPSLQPYI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttctcaattttcttctcggcgctgctgccgtcgggtcagcgctggcggctccg
gccccggcgccagtctgtgatgccccgaccaagcgggcaaccaagttccagttcgttggc
gtcaaccaatccggtgctgagttcggaaaagatactctgcctggccagcttggaaaacac
tacacctggccggtgaggtcgagtatcgacgccttgatgggcaagggattcaacactttc
cgcattgctttcatgatggaacgcattgttcccaacaagcttgatggcccacttgatgcc
acttatgccagcggcctgactgatctccagatcgtcaactatgtcaccagcaaaggcgcc
tatgccatcattgacccccacaactttggccgctactacaacaacgtcataaccgatgta
gctggcttcgcggcctggtggaccaccattgccaagctcttcgtcaacaacgacaaggtc
atctttgacaccaacaacgagtatcacgacatggctgatgatctagtccgccgcctcaac
caagctgctatcgacgccatccgtgccacgggagcgacggctcagtacatcatggtcgaa
ggaaactcttggactggcgcttggacctgggtatcctcgggcaacggagccaacctcctc
tccctccgcgatccagccgactcgacgggcgagaagattatttaccaaatgcaccagtac
ctcgacagcgacggctccggcacctcggaaacctgcgtttcccgcaccatcggcgctgaa
cgtgtccgtgctgctaccgagtggctgaagcagaataagaagaagggcttcctcggagag
acagccggcggggccaacaccaactgcattgctgccctgacaggaatgctgagttacctg
cagcagaacaacgatgtctggactggctgggcttggtggggaggcggcccatggtgggga
aactacatgtttgcaatggagccgccgtccagtgtggcgtatgatcgggttttgcctagt
ctgcagccgtatatctag

DBGET integrated database retrieval system