KEGG   Podospora anserina: PODANSg1167Help
Entry
PODANSg1167       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
Organism
pan  Podospora anserina
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 378 aa AA seqDB search
MASVAQAAAVVRQTEGFAPGADGKYTISAPGIKAQFIPYGATLTNLFVRDKNGDDIDVVL
GYDDIDYYPVDPGHPVYNAIPGRYANRIGNGKYSIGGVEYTTQKNDGDNTLHSGTNNWSF
RFWDVTALSEDSITFSILDKSNSSQGFFGDVKSSVTYSVTDSTWKIKITADSLDQKTPIL
LTQHTYFNLDAYRNPATSLIWDHTLHLPYSSRYLEADQGALPTGKILTAAPGSINDFASS
ANLKFGHSRDDPKFQGNCGANGACEGYNGYWLIEDAPEDAVVLTLASEFSGVKAELRTDQ
PGVVIYSCSWMDGSADVKKSTQGLGEKNNKVVKSSCVAIEAQDYPDGINKPEWGRLEKQI
FGPGERYVQETSWTFGLV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggtcgctcaggcagcggcggttgttcgccagactgaagggtttgccccgggt
gctgatgggaaatataccatttccgctcctgggatcaaggctcagttcatcccctacggc
gccacgctcaccaacctctttgttagagacaagaacggcgatgatattgatgttgtgttg
ggatacgacgacattgactactaccccgtcgacccaggccatcccgtctacaacgccatc
ccgggacgctacgccaaccgcatcggcaacgggaaatactccatcggcggcgtcgagtac
accacgcagaaaaacgacggcgacaacaccctccacagcgggacgaacaactggtcgttc
cgcttctgggacgtgactgccctgtcggaggactcgatcactttttcgattttggacaag
tccaactcttcccaggggtttttcggcgatgtcaagtcgagcgtgacatacagcgttacc
gacagcacgtggaaaataaagatcacggctgattcgcttgatcaaaagactccgatcctc
ctgactcagcacacctacttcaacctcgacgcctaccgcaacccggccacctccctgatc
tgggaccacaccctccacctcccctactcctcccgctacctcgaagccgaccaaggcgcc
ctccccaccggcaagatcctcaccgccgccccgggctccatcaacgacttcgcctcctcc
gccaacctcaagttcggccactcccgcgatgaccccaagttccagggcaactgcggcgcc
aacggcgcgtgcgaggggtacaacgggtactggctcatcgaggacgcccccgaggacgcg
gtcgtcctgacgctggcgagcgagtttagtggtgtcaaggcggagctgaggactgatcag
cccggggtggtgatttattcttgctcgtggatggacgggagcgcggacgtgaagaagagc
acccaggggctgggggagaagaacaacaaggttgtcaagagcagctgtgtcgcgattgag
gcgcaggattatcctgatgggattaacaagccggagtggggacgtctcgagaagcagatc
tttgggccgggggagcggtatgttcaggagacttcttggacttttggactggtttaa

DBGET integrated database retrieval system