KEGG   Podospora anserina: PODANSg1267Help
Entry
PODANSg1267       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pan  Podospora anserina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PODANSg1267
   00052 Galactose metabolism
    PODANSg1267
Enzymes [BR:pan01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PODANSg1267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 344 aa AA seqDB search
MSSDAPLVSFLPLGAIIQELRVGDLNIVQGFPTQDLYVSHNGPFFGETIGRVANRISNAK
LDSLNGGKTYSLAANNGVNNLHGGVVGWGKRVWDGPVPVGVREIPGVGKIEGGESVKFTL
VSEDGDEGFPGEVKATVVYTVGKQTEGGKEVVVLGMEYEAELVGEGVEETVVNMTNHSYF
NLTGGSSIEGTEVTLVTNNYLPVDDGGIPTGGPAPFAKVQGQTPFVLGAQEPDIDDCFVV
NEAAGSIPIDTRAESLTKLVSARHPETGIHLEVLSTEPAFQFYTGKYIDVPEVAGIPARK
ARSGFCVEPSRYVNAANVPEWKSQMLLKKGEKYGTRTVYRAWKE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgacgcccccctcgtctcttttctccctttgggagccatcatccaagagctt
cgcgtcggcgacctcaatatcgtccagggcttccccactcaggacctctacgtctcccac
aacggccccttctttggggagaccatcggccgggttgcgaaccgcatctctaatgccaag
cttgatagtctgaatgggggcaagacgtatagcttggctgcgaacaacggggtgaataac
ctccacggaggagtcgttggttgggggaagagggtctgggatgggccggttcctgttggt
gtcagagagattcctggggtgggcaagattgaaggcggggagagcgttaagtttacgctt
gtgagcgaggatggggatgaggggtttccgggggaggtgaaggcgacggtggtgtatact
gtgggcaagcagacggagggggggaaggaggttgttgtgctggggatggagtacgaggct
gagctggttggggagggggtggaggagacggttgtcaatatgacgaatcactcttacttc
aaccttaccggcggctcgtcaatcgaaggcacggaggtcaccctcgtgacgaacaactac
ctccccgttgacgacggcggtattcctaccggcggtcccgccccctttgccaaggtccag
ggacagactccgtttgttcttggtgctcaagagccggatattgacgactgcttcgttgtt
aacgaggccgctggttctattcctatcgacacccgcgccgagtccctgaccaagctcgtc
agcgctagacaccccgagactggcatccacctcgaggttctcagcaccgagcccgccttc
cagttctatactggcaagtacattgacgtgcctgaggtggctggcatcccggcgcgcaag
gccagaagtgggttctgtgtcgagccgagccgttatgtgaatgcggcgaatgtgcccgag
tggaagagccagatgctgctcaagaagggggagaagtacgggacgaggactgtgtacagg
gcttggaaggagtag

DBGET integrated database retrieval system